Recombinant Schizosaccharomyces pombe Sporulation-specific protein spo7 (spo7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe Sporulation-Specific Protein spo7 (spo7)

Schizosaccharomyces pombe sporulation-specific protein spo7 (Spo7) is a protein crucial for sporulation, a unique cell division process in fission yeast where a new cell develops within a mother cell's cytoplasm . This process involves the formation of the forespore membrane (FSM), which eventually becomes the plasma membrane of the spores . Spo7 is essential for the initiation of FSM assembly but not for the modification of the spindle pole body (SPB) .

Gene Identification and Expression

The spo7 gene, also known as mug79+, is upregulated during meiosis . Functional complementation identified it, with an open reading frame (ORF) of 3.9 kb . Northern blot analysis indicates that spo7 mRNA is scarce in vegetative cells but increases sharply when shifted to nitrogen-free medium . During sporulation, transcription of spo7 is induced around 5 hours after the temperature shift, peaking at 6–7 hours during meiosis I .

Protein Interactions and Localization

Spo7 interacts with Meu14, a leading-edge component of the FSM, and is necessary for Meu14's proper localization . Yeast two-hybrid analysis reveals a positive interaction between Spo7 and Spo13, another meiotic SPB component . During meiosis I, Spo13-GFP is observed at the SPB before Spo7-CFP, suggesting Spo13 is recruited earlier . Western blot analysis confirms that both Spo7-HA and Spo13-GFP are expressed during meiosis II, with Spo13-GFP appearing slightly earlier than Spo7-HA .

Functional Significance of the PH Domain

Spo7 contains a pleckstrin homology (PH) domain that binds to phosphatidylinositol 3-phosphate (PI3P) . spo7 mutants lacking the PH domain exhibit abnormal spore morphology, similar to meu14 and phosphatidylinositol 3-kinase (pik3) mutants . This indicates that the PH domain is critical for the proper function of Spo7 in coordinating the formation of the leading edge and the initiation of FSM assembly .

Role in Forespore Membrane Assembly

Spo7 coordinates the formation of the leading edge and the initiation of FSM assembly, which is essential for accurate FSM formation . Another protein, Spo3, is also a key component of the forespore membrane and collaborates with syntaxin-like protein Psy1 in its assembly . In spo3 null mutants, the forespore membrane initiates but fails to develop normally, with membrane vesicles accumulating in the cytoplasm of immature asci .

Key Findings and Research Data

FeatureDescription
Genespo7 (mug79+)
Protein DomainPleckstrin Homology (PH) domain
ExpressionUpregulated during meiosis, peaking at 6-7 hours after induction
Essential ForInitiation of FSM assembly, proper localization of Meu14
Interacting ProteinsMeu14, Spo13
Mutant Phenotype (PH domain deletion)Aberrant spore morphology, similar to meu14 and pik3 mutants
FunctionCoordinates leading edge formation and FSM assembly
mRNABarely detectable in vegetative cells, accumulates sharply after shifting to nitrogen-free medium
Timing of TranscriptionInduced at 5 h after the temperature shift and peaked at 6–7 h, when cells were in meiosis I
Interaction with Spo13During meiosis I, Spo13-GFP signal was observed at the SPB, whereas Spo7-CFP was not detected, indicating that Spo13 is recruited to the SPB prior to Spo7. Consistently, Western blot analysis showed that both Spo7-HA and Spo13-GFP were expressed exclusively during meiosis II

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its implementation.
Synonyms
spo7; SPBC902.03; Sporulation-specific protein spo7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
spo7
Target Protein Sequence
MSSYVPNTLSVYHNLLILEASFRKTYLQLQVRRQKYMAFYVSLLVWNFYFGYRVFYRISK YSLIDLTYKLCLLCGIVTLLLFYFSGLYRTTIVYPSRYVQQVNKAMRFFNIRLVITPVPW FQVRKPLDCGVHLILSSKRFDILVIEGWEAFRSSYFASIHRKNNSIQSNESSESPSSKQN
Uniprot No.

Target Background

Function

Probable regulatory component of the Nem1-Spo7 complex, a phosphatase potentially involved in maintaining proper nuclear membrane morphology.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Spo7 and what is its role in S. pombe sporulation?

Spo7 is a sporulation-specific protein in Schizosaccharomyces pombe that functions as a novel spindle pole body (SPB) component. It contains a pleckstrin homology (PH) domain and is essential for the initiation of forespore membrane (FSM) assembly, which becomes the plasma membrane of spores . Sporulation in S. pombe represents a unique mode of cell division where a new cell forms within the cytoplasm of a mother cell, allowing the organism to survive in nutrient-poor environments . Spo7 coordinates the formation of the leading edge and initiation of FSM assembly, thereby ensuring accurate formation of the FSM during sporulation .

When is Spo7 expressed during the S. pombe life cycle?

Spo7 expression is tightly regulated and specific to meiosis and sporulation. Northern blot analysis has revealed that Spo7 mRNA is barely detectable in vegetative cells but accumulates sharply after shifting to nitrogen-free medium . In synchronized meiosis experiments using the pat1-114 strain, Spo7 transcription is induced at approximately 5 hours after temperature shift and peaks at 6-7 hours when cells are in meiosis I . Western blot analysis confirms that Spo7 is expressed exclusively during meiosis II . This strict temporal regulation suggests that Spo7 function is specific to the sporulation process.

What triggers the expression of Spo7 in S. pombe?

The expression of Spo7 is triggered primarily by nutrient starvation, particularly nitrogen depletion, which terminates mitosis and initiates sexual differentiation in S. pombe . The gene encoding Spo7 was previously identified as mug79+, a meiosis-up-regulated gene . The transcription of Spo7 appears to be regulated by the forkhead transcription factor Mei4, which controls many genes required for meiosis and sporulation . This regulatory mechanism ensures that Spo7 is only expressed when environmental conditions necessitate sporulation as a survival strategy.

What are the key structural domains of Spo7 and their significance?

Spo7 is a protein containing a pleckstrin homology (PH) domain, which is crucial for its function . The full-length protein consists of 180 amino acids with a sequence that includes features typical of membrane-associated proteins . The PH domain of Spo7 has specific affinity for phosphatidylinositol 3-phosphate (PI3P), which likely facilitates its interaction with membrane components during FSM formation . Mutants lacking the PH domain show aberrant spore morphology, similar to that seen in meu14 and phosphatidylinositol 3-kinase (pik3) mutants, demonstrating the critical importance of this domain for proper FSM assembly and spore formation .

What protein interactions are essential for Spo7 function?

Spo7 directly binds to Meu14, a component of the leading edge of the FSM, and is essential for proper localization of Meu14 . Through yeast two-hybrid analysis, Spo7 has also been shown to interact with Spo13, another sporulation-specific SPB component . Additionally, Spo7 can interact with itself, suggesting potential oligomerization . In contrast to its interaction with Spo13, no direct interaction between Spo7 and other SPB components like Spo2 or Spo15 has been observed . These specific protein interactions are crucial for coordinating the assembly of the FSM during sporulation.

How does Spo7 localization change during the sporulation process?

During early meiosis, Spo7 is not detectable at the SPB. Spo7 localizes to the SPB specifically during meiosis II, after Spo13 has already been recruited . The localization of Spo7 to the SPB is dependent on both Spo15 and Spo2, whereas Spo2 localization depends only on Spo15 . This suggests a hierarchical recruitment process where Spo15 localizes first, followed by Spo2, and finally Spo7 . Once at the SPB, Spo7 localizes to the cytoplasmic side in close contact with the nascent FSM, where it plays a crucial role in coordinating FSM assembly .

What techniques are most effective for detecting Spo7 expression and localization?

For detecting Spo7 expression, Northern blot analysis can be used to monitor mRNA levels, while Western blot analysis with tagged versions of Spo7 (such as Spo7-HA) can track protein expression . For localization studies, fluorescent fusion proteins (like Spo7-CFP or Spo7-GFP) combined with fluorescence microscopy have proven effective . Since Spo7 is specifically expressed during meiosis and sporulation, researchers typically induce synchronous meiosis using temperature-sensitive pat1-114 strains to facilitate temporal analysis . For co-localization studies, other meiotic SPB components or FSM markers can be labeled with different fluorescent proteins, such as Spo13-GFP or Psy1 (a SNARE family member that labels the FSM) .

How can recombinant Spo7 protein be effectively produced and purified?

Recombinant Spo7 can be produced using bacterial or yeast expression systems. For bacterial expression, the coding sequence of Spo7 can be cloned into appropriate expression vectors with affinity tags such as GST or His-tag to facilitate purification . When using yeast expression systems, the Spo7 gene can be placed under the control of inducible promoters like nmt41 or nmt42 . Purification typically involves affinity chromatography using glutathione beads for GST-tagged proteins or nickel columns for His-tagged proteins . Storage of purified Spo7 is recommended in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

What are the key considerations for designing genetic studies of Spo7 function?

When designing genetic studies of Spo7 function, researchers should consider:

  • Marker selection: Creating functional tagged versions (GFP, HA, etc.) without disrupting protein function.

  • Knockout strategies: Generating complete deletions or domain-specific mutations (particularly in the PH domain).

  • Complementation tests: Using plasmids expressing wild-type Spo7 to rescue sporulation deficiency in spo7 mutants .

  • Temperature sensitivity: Some sporulation mutants show temperature-dependent phenotypes.

  • Synchronization methods: Using pat1-114 temperature-sensitive mutants for synchronized meiosis studies .

  • Double mutants: Creating strains with mutations in both Spo7 and interacting proteins (like Meu14, Spo13) to study genetic interactions.

When analyzing results, researchers should examine both meiotic progression and spore formation, as defects in Spo7 specifically affect sporulation without impairing meiotic nuclear divisions .

How does Spo7 coordinate with phosphoinositide signaling during FSM formation?

The PH domain of Spo7 displays affinity for phosphatidylinositol 3-phosphate (PI3P), suggesting a link between phosphoinositide signaling and FSM formation . Advanced research in this area should focus on:

  • Lipid binding specificity: Quantitative binding assays to determine the specificity and affinity of Spo7's PH domain for different phosphoinositides.

  • Functional consequences: Analysis of how phosphoinositide binding influences Spo7's ability to coordinate FSM assembly.

  • Regulatory mechanisms: Investigation of whether phosphorylation or other post-translational modifications modulate the lipid-binding properties of Spo7.

  • Pathway integration: Exploring the relationship between PI3-kinase activity, PI3P production, and Spo7 function during sporulation.

Mutations in the PH domain resulting in aberrant spore morphology, similar to phosphatidylinositol 3-kinase (pik3) mutants, support a model where Spo7 serves as an effector of phosphoinositide signaling during FSM formation .

What is the relationship between Spo7 function and chronological lifespan in S. pombe?

S. pombe employs two main strategies to adapt to nutrient starvation: sporulation via sexual differentiation and extension of chronological lifespan (CLS) . Research questions exploring the relationship between these processes include:

  • Shared regulatory pathways: Do Spo7 and CLS extension share upstream regulators such as TORC1, PKA, or Sty1 MAPK?

  • Metabolic connections: How do metabolic changes during nutrient starvation influence both Spo7 expression and CLS extension?

  • Trade-off mechanisms: Is there a cellular decision point that directs resources toward either sporulation (Spo7-dependent) or CLS extension?

  • Evolutionary significance: Why maintain both strategies, and how do they complement each other for survival in resource-poor environments?

Comparative measurements have shown that spore cells achieve an extremely long survival period compared to stationary phase cells , suggesting that the Spo7-dependent sporulation pathway provides superior long-term survival benefits.

How does the SPB modification process integrate multiple proteins including Spo7?

The spindle pole body undergoes modification during meiosis to form outer plaques from which FSM assembly is initiated . Advanced research questions regarding this process include:

  • Temporal sequence: What is the precise order of recruitment of Spo15, Spo2, Spo13, and Spo7 to the SPB?

  • Structural changes: How does the incorporation of these proteins physically modify the SPB structure?

  • Signal transduction: What signals trigger the recruitment of each component, and how is this coordinated with meiotic progression?

  • Protein-protein interaction network: How do direct and indirect interactions between these components stabilize the modified SPB?

Current evidence suggests a hierarchical assembly where Spo15 is required for Spo2 localization, which in turn is necessary for Spo7 and Spo13 recruitment . This ordered assembly likely ensures that FSM formation is properly coordinated with nuclear division during sporulation.

What are common challenges in detecting native Spo7 expression, and how can they be addressed?

Detection of native Spo7 expression presents several challenges:

  • Low abundance: Spo7 is expressed at low levels, making detection difficult by standard Western blotting.

    • Solution: Use more sensitive detection methods such as enhanced chemiluminescence or fluorescent antibodies.

  • Temporal specificity: Spo7 is only expressed during a specific window of meiosis II.

    • Solution: Synchronize meiosis using temperature-sensitive pat1-114 mutants and collect samples at appropriate time points (6-7 hours after temperature shift) .

  • Protein stability: Sporulation proteins may be rapidly degraded.

    • Solution: Use protease inhibitors during protein extraction and process samples quickly at low temperatures.

  • Background signals: High background may obscure specific signals.

    • Solution: Use tagged versions of Spo7 (HA, GFP) for which specific antibodies with low background are available .

How can researchers distinguish phenotypes caused by Spo7 dysfunction from other sporulation defects?

Distinguishing Spo7-specific phenotypes requires careful analysis:

  • Meiotic progression: Unlike some sporulation mutants, spo7 mutants progress normally through meiosis but fail specifically in FSM formation .

    • Method: Monitor nuclear divisions using DAPI staining or histone-GFP markers.

  • SPB modification: Spo7 is essential for FSM assembly initiation but not for SPB modification.

    • Method: Examine SPB structure using electron microscopy or fluorescent markers for SPB components like Sad1 and Pcp1 .

  • FSM formation stages: Different proteins affect distinct stages of FSM formation.

    • Method: Use fluorescent markers like Psy1 (SNARE family member) to label the FSM and distinguish initiation defects from expansion defects .

  • Genetic epistasis: Determine the relationship between Spo7 and other sporulation genes.

    • Method: Create double mutants and analyze which phenotype predominates to establish pathway relationships.

What controls should be included when analyzing Spo7 protein interactions?

When studying Spo7 protein interactions, several controls are essential:

  • Negative controls for two-hybrid assays:

    • Empty vector controls to rule out auto-activation.

    • Unrelated protein pairs to establish background interaction levels.

    • Testing Spo7 against proteins known not to interact, such as Spo15 .

  • Positive controls for co-immunoprecipitation:

    • Input samples to verify protein expression.

    • Known interacting protein pairs as positive controls.

    • GST-only or GFP-only controls to identify non-specific binding .

  • Reciprocal experiments:

    • If Protein A pulls down Protein B, test whether Protein B can pull down Protein A.

    • Use different tags (e.g., GST, HA, GFP) to ensure tag-specific artifacts are not misinterpreted.

  • Competition assays:

    • Add excess untagged protein to test if it competes with tagged protein for binding.

    • This confirms specificity of the observed interactions.

How might comparative studies of Spo7 across different yeast species advance our understanding of sporulation mechanisms?

Comparative studies across yeast species could provide valuable insights:

  • Evolutionary conservation: Identify conserved domains and functions of Spo7-like proteins across Schizosaccharomyces species and more distantly related fungi.

  • Functional divergence: Determine whether Spo7 homologs in other yeasts (if present) serve similar roles in sporulation or have acquired different functions.

  • Structural adaptations: Compare the PH domains of Spo7-like proteins to understand how their lipid-binding properties may have evolved.

  • Regulatory network comparison: Analyze how the transcriptional and post-translational regulation of Spo7 and its homologs differs across species.

Such comparative analyses could reveal fundamental principles of sporulation that are conserved across fungal evolution and identify species-specific adaptations that reflect different ecological niches.

What are potential applications of understanding Spo7 function beyond basic yeast biology?

Understanding Spo7 function has broader implications:

  • Cell division mechanisms: Insights into how Spo7 coordinates membrane formation during sporulation may inform our understanding of membrane dynamics during cell division in higher eukaryotes.

  • Stress response pathways: The role of Spo7 in the sporulation response to nutrient starvation may reveal conserved principles of cellular stress adaptation.

  • Developmental biology: Mechanisms of cellular differentiation during sporulation may have parallels in developmental processes in multicellular organisms.

  • Biotechnological applications: Engineering yeast sporulation efficiency through manipulation of Spo7 and related proteins could enhance strain preservation and genetic manipulation techniques.

As a component of a fundamental cellular process, deeper understanding of Spo7 function may reveal principles applicable to diverse biological systems beyond yeast.

How might advanced imaging techniques enhance our understanding of Spo7 dynamics during sporulation?

Advanced imaging approaches could reveal new aspects of Spo7 function:

  • Super-resolution microscopy: Techniques like STORM or PALM could reveal the precise spatial organization of Spo7 at the SPB and leading edge of the FSM at nanometer resolution.

  • Live-cell imaging: Real-time visualization of Spo7-fluorescent protein fusions could track the dynamics of Spo7 recruitment and movement during FSM formation.

  • Correlative light and electron microscopy (CLEM): Combining fluorescence microscopy with electron microscopy could relate Spo7 localization to ultrastructural features of the SPB and FSM.

  • FRET or BRET analysis: These techniques could measure protein-protein interactions between Spo7 and its binding partners in living cells during sporulation.

  • Lattice light-sheet microscopy: This could enable long-term 3D imaging of the entire sporulation process with minimal phototoxicity.

These approaches would provide dynamic information about Spo7 behavior that cannot be obtained from fixed-cell imaging or biochemical assays alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.