Recombinant Schizosaccharomyces pombe Squalene synthase (erg9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
erg9; SPBC646.05c; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
erg9
Target Protein Sequence
MSLANRIEEIRCLCQYKLWNDLPSYGEDENVPQNIRRCYQLLDMTSRSFAVVIKELPNGI REAVMIFYLVLRGLDTVEDDMTLPLDKKLPILRDFYKTIEVEGWTFNESGPNEKDRQLLV EFDVVIKEYLNLSEGYRNVISNITKEMGDGMAYYASLAEKNDGFSVETIEDFNKYCHYVA GLVGIGLSRLFAQSKLEDPDLAHSQAISNSLGLFLQKVNIIRDYREDFDDNRHFWPREIW SKYTSSFGDLCLPDNSEKALECLSDMTANALTHATDALVYLSQLKTQEIFNFCAIPQVMA IATLAAVFRNPDVFQTNVKIRKGQAVQIILHSVNLKNVCDLFLRYTRDIHYKNTPKDPNF LKISIECGKIEQVSESLFPRRFREMYEKAYVSKLSEQKKGNGTQKAILNDEQKELYRKDL QKLGISILFVFFIILVCLAVIFYVFNIRIHWSDFKELNLF
Uniprot No.

Target Background

Function

Squalene synthase (Erg9) from Schizosaccharomyces pombe catalyzes the condensation of two farnesyl pyrophosphate molecules to form squalene. This is the first committed step in the sterol biosynthesis pathway and is essential for ergosterol biosynthesis.

Database Links
Protein Families
Phytoene/squalene synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Squalene synthase (erg9) and what is its role in sterol biosynthesis?

Squalene synthase (farnesyl diphosphate:farnesyl diphosphate farnesyltransferase; EC 2.5.1.21) in S. pombe, encoded by the ERG9 gene, catalyzes a critical step in sterol biosynthesis. The enzyme functions by condensing two farnesyl diphosphate molecules to form squalene, representing the first committed step in sterol biosynthesis that branches from the general isoprenoid pathway. This reaction is considered a major control point for the regulation of isoprene and sterol biosynthesis in eukaryotes including yeasts and humans . The enzyme's position at this branch point makes it especially important for maintaining proper sterol levels while balancing with other isoprenoid pathways. S. pombe requires ergosterol for normal growth and membrane function, making squalene synthase essential under standard laboratory conditions .

How conserved is Squalene synthase across different species?

Squalene synthase demonstrates remarkable conservation across evolutionary distant eukaryotes. Extensive structural and functional conservation exists between the enzymes from humans, budding yeast (Saccharomyces cerevisiae), and fission yeast (Schizosaccharomyces pombe) . Sequence analysis of these proteins reveals significant homology, particularly in regions proposed to interact with the prenyl substrates (two farnesyl diphosphate molecules). Functional studies have confirmed this conservation, as expression of S. pombe squalene synthase or hybrid human-S. cerevisiae squalene synthetases can functionally replace the native enzyme in S. cerevisiae cells with ERG9 gene disruptions . This complementation restores ergosterol biosynthesis and reverses the ergosterol requirement of these cells, demonstrating that despite evolutionary distance, the catalytic function remains highly preserved .

What are the structural characteristics of S. pombe Squalene synthase?

S. pombe squalene synthase shares key structural features with its orthologs from other species. Based on sequence analysis, the enzyme is predicted to be a C-terminal membrane-spanning protein of approximately 50 kDa . Its hydropathy profile closely resembles those of human and S. cerevisiae counterparts, suggesting similar membrane association patterns. The protein contains highly conserved regions that are proposed to interact with its prenyl substrates (farnesyl diphosphate molecules) . Many of these conserved regions are also present in phytoene and prephytoene diphosphate synthetases, enzymes which catalyze prenyl substrate condensation reactions analogous to that of squalene synthase, indicating functional domain conservation across even more diverse enzyme families . The membrane association is critical for the enzyme's biological function, as it positions the enzyme at the endoplasmic reticulum where sterol biosynthesis occurs.

How is the ERG9 gene regulated in yeast?

The regulation of ERG9 in yeasts is complex and responds to multiple cellular and environmental factors. While much of the detailed regulatory information comes from studies in S. cerevisiae, similar mechanisms likely operate in S. pombe. In S. cerevisiae, ERG9 expression increases in response to mutations in sterol biosynthetic genes (ERG3, ERG7, ERG24), suggesting feedback regulation when sterol production is compromised . Treatment with sterol biosynthesis inhibitors such as zaragozic acid (targeting squalene synthase) and ketoconazole (targeting C-14 sterol demethylase) also increases ERG9 expression, further supporting a compensatory feedback mechanism .

Several transcription factors regulate ERG9 expression in S. cerevisiae, including heme activator proteins (HAP1 and HAP2/3/4), yeast activator protein (yAP-1), and the phospholipid transcription factor complex INO2/4 . ERG9 expression decreases in hap1, hap2/3/4, and yap-1 mutants, while ino2/4 mutants show increased expression. Oxygen availability also influences expression, with anaerobic conditions decreasing ERG9 expression . This multilayered regulation is consistent with squalene synthase's crucial role as the first dedicated step in sterol biosynthesis.

What experimental systems can be used to study S. pombe Squalene synthase function?

Several experimental systems have proven effective for studying S. pombe squalene synthase:

  • Heterologous Expression Systems: S. pombe ERG9 can be expressed in S. cerevisiae strains with ERG9 gene disruptions to assess functional conservation and perform structure-function studies . This complementation approach allows researchers to test whether modified versions of the enzyme retain catalytic activity.

  • Promoter Fusion Assays: Similar to studies in S. cerevisiae, ERG9 promoter-reporter gene fusions (e.g., ERG9-lacZ) can be constructed to monitor transcriptional regulation under various conditions or in different genetic backgrounds .

  • Genetic Interaction Mapping: Systematic genetic interaction (GI) analysis in S. pombe can reveal functional relationships between ERG9 and other genes. Comparing these interactions with those observed in S. cerevisiae can identify conserved and divergent aspects of squalene synthase function .

  • Drug Inhibition Studies: Treatment with squalene synthase inhibitors like zaragozic acid provides insights into the enzyme's role and regulatory responses .

  • Regulated Expression Systems: Placing ERG9 under control of regulatable promoters allows for controlled depletion of the enzyme to study the consequences of reduced squalene synthase activity .

How can heterologous expression systems be optimized for functional studies of S. pombe ERG9?

Optimizing heterologous expression systems for S. pombe ERG9 requires careful consideration of several factors. When expressing the gene in S. cerevisiae for complementation studies, codon optimization may enhance expression efficiency since there are differences in codon usage between the two yeasts. The choice of promoter is also critical—while constitutive promoters like GPD can provide high-level expression, inducible promoters such as GAL1 allow for temporal control of expression. This control is particularly valuable when studying potential toxic effects of overexpression or for creating conditional mutants .

For membrane proteins like squalene synthase, proper folding and membrane integration are essential for function. Expression should be monitored not only at the mRNA level but also at the protein level using techniques such as Western blotting with epitope tags, which should be carefully positioned to avoid interfering with enzyme function. Additionally, when creating hybrid enzymes (such as human-S. cerevisiae squalene synthetase constructs), domain boundaries must be carefully selected based on sequence conservation analysis to maintain proper protein folding and function . Functional complementation can be assessed by measuring growth of ERG9-disrupted S. cerevisiae strains under aerobic conditions or by directly measuring ergosterol levels using HPLC or mass spectrometry.

What are the implications of structural and functional conservation between human and fungal squalene synthetases for drug development?

An important consideration from therapeutic studies is the observation that depletion of ERG9 in Candida glabrata did not affect fungal growth in mice, as the cells were able to incorporate cholesterol from serum, suggesting potential limitations for squalene synthase inhibitors as antifungals against certain pathogens . This highlights the importance of understanding sterol uptake and utilization mechanisms when targeting sterol biosynthesis for antifungal development.

How does inhibition of ERG9 affect sterol metabolism and cellular function in S. pombe compared to other yeasts?

Inhibition of ERG9 affects sterol metabolism and cellular function differently across yeast species due to variations in sterol requirements and exogenous sterol utilization capabilities. In S. cerevisiae, ERG9 inhibition by zaragozic acid leads to depletion of ergosterol and accumulation of farnesyl diphosphate, resulting in growth inhibition unless the medium is supplemented with ergosterol under anaerobic conditions . The inhibition also triggers compensatory upregulation of ERG9 expression, suggesting a feedback mechanism that attempts to restore sterol homeostasis .

In pathogenic fungi such as Candida glabrata, genetic depletion of ERG9 decreases cell viability in laboratory media but surprisingly does not affect growth in mice . This discrepancy is due to the ability of C. glabrata to incorporate exogenous cholesterol from serum, which compensates for the defect in ergosterol biosynthesis . This phenomenon may differ in S. pombe, which has distinct sterol requirements and potentially different capabilities for exogenous sterol uptake.

Comparative studies between S. pombe and other yeasts can help identify species-specific responses to ERG9 inhibition. Techniques such as lipidomics analysis after ERG9 inhibition or depletion would reveal differences in sterol intermediate accumulation and membrane lipid composition adjustments. Additionally, transcriptomic comparisons would identify divergent compensatory mechanisms activated in response to sterol depletion. These differences could be exploited for selective targeting of specific fungal pathogens.

What genetic interactions does ERG9 have in S. pombe and how do they differ from those in S. cerevisiae?

Genetic interaction (GI) analysis provides valuable insights into the functional relationships between genes. While specific ERG9 genetic interactions in S. pombe are not directly detailed in the provided search results, comparing genetic networks between S. pombe and S. cerevisiae can reveal both conserved and divergent aspects of sterol biosynthesis regulation .

To comprehensively map ERG9 genetic interactions in S. pombe, systematic double mutant analysis could be performed using techniques such as synthetic genetic array (SGA) analysis or parallel deletion analysis (PDA). Comparing the resulting interaction profiles with those from S. cerevisiae would identify conserved and divergent functional relationships, potentially revealing novel aspects of sterol biosynthesis regulation in S. pombe .

What methodologies can be used to study the effects of transcriptional regulation on S. pombe ERG9 expression?

Several methodologies can be employed to study transcriptional regulation of S. pombe ERG9:

  • Promoter-Reporter Fusions: Creating fusions between the ERG9 promoter and reporter genes (such as lacZ, GFP, or luciferase) allows quantitative measurement of promoter activity under various conditions or in different genetic backgrounds . This approach was successfully used in S. cerevisiae to identify transcription factors and conditions affecting ERG9 expression.

  • Chromatin Immunoprecipitation (ChIP): ChIP experiments can identify transcription factors that directly bind to the ERG9 promoter and how this binding changes under different conditions. ChIP-seq would provide genome-wide binding profiles for transcription factors of interest .

  • Transcriptomic Analysis: RNA-seq or microarray analysis comparing wild-type and transcription factor mutants (such as hap1, hap2/3/4, yap-1 homologs in S. pombe) can identify genes whose expression is co-regulated with ERG9, revealing potential shared regulatory mechanisms .

  • CRISPR-Based Transcriptional Modulation: CRISPRi or CRISPRa technologies can be adapted to repress or activate the ERG9 promoter in S. pombe, allowing for precise manipulation of expression levels without altering the coding sequence.

  • Motif Analysis and Mutagenesis: Computational prediction of transcription factor binding sites in the ERG9 promoter, followed by site-directed mutagenesis of these motifs in promoter-reporter constructs, can identify functional regulatory elements.

The response of ERG9 expression to various perturbations, such as sterol biosynthesis inhibitors, oxygen limitation, or heme depletion, would be particularly informative for understanding its regulation mechanisms . Comparative analysis with S. cerevisiae would highlight conserved and divergent aspects of this regulation.

How should researchers design experiments to study S. pombe ERG9 function in vivo?

Designing effective experiments to study S. pombe ERG9 function in vivo requires careful consideration of several factors. First, researchers must determine whether to study the native gene or use recombinant approaches. For studying the endogenous gene, CRISPR-Cas9 technology can be used for precise genome editing to introduce mutations or regulatory elements. Alternatively, placing ERG9 under an inducible promoter (such as the nmt1 promoter with varying strengths) allows for controlled expression .

When creating ERG9 mutants, researchers should consider using a plasmid-based complementation system. Since ERG9 is likely essential, mutations should be introduced into plasmids and transformed into strains where the genomic copy is under an inducible promoter that can be repressed. The functional consequences of mutations can then be assessed by measuring growth, sterol composition, and membrane properties .

For imaging studies, C-terminal tagging with fluorescent proteins must be approached cautiously since squalene synthase has a C-terminal membrane anchor. N-terminal tagging or internal tagging at permissive sites identified through sequence alignment with characterized orthologs may be preferable. Co-localization with ER markers would confirm proper targeting of the protein .

Lipidomic analysis using techniques such as gas chromatography-mass spectrometry (GC-MS) or liquid chromatography-mass spectrometry (LC-MS) provides quantitative data on sterol composition changes resulting from ERG9 manipulation. These techniques should be paired with phenotypic assays examining growth rates, stress responses, and membrane integrity to comprehensively assess the impact of altered squalene synthase function.

What are the key considerations for purifying recombinant S. pombe Squalene synthase for biochemical studies?

Purifying recombinant S. pombe squalene synthase presents several challenges due to its nature as a membrane-bound enzyme. The following considerations are critical for successful purification:

  • Expression System Selection: While E. coli is commonly used for recombinant protein expression, eukaryotic systems such as yeast (S. cerevisiae), insect cells, or mammalian cells may provide better expression of functional S. pombe squalene synthase due to appropriate membrane insertion machinery and post-translational modifications .

  • Construct Design: Several approaches can be employed:

    • Full-length protein with its native membrane anchor

    • Truncated constructs removing the C-terminal membrane domain to improve solubility

    • Fusion proteins with solubility or affinity tags (His, GST, MBP) positioned to avoid interference with catalytic activity

    • Codon optimization for the chosen expression system

  • Membrane Protein Solubilization: Careful selection of detergents is crucial for extracting the enzyme from membranes while maintaining activity. A detergent screen should be performed testing mild non-ionic detergents (such as DDM, LMNG, or digitonin) at various concentrations. Alternative approaches include the use of amphipols or nanodiscs to maintain a lipid-like environment .

  • Purification Strategy: A multi-step purification approach is recommended:

    • Affinity chromatography using engineered tags

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing and buffer exchange

    • Throughout purification, include stabilizing agents such as glycerol and potentially substrate analogs

  • Activity Assays: Verification of enzyme activity is essential using radiometric or spectrophotometric assays that measure the conversion of farnesyl diphosphate to squalene. Activity should be tested after each purification step to ensure the protein remains functional .

For structural studies, stability testing using techniques such as differential scanning fluorimetry can help identify optimal buffer conditions that maintain protein integrity during concentration and crystallization attempts.

How can researchers effectively analyze the impact of ERG9 mutations on S. pombe sterol biosynthesis?

Analyzing the impact of ERG9 mutations on S. pombe sterol biosynthesis requires a multi-faceted approach combining genetic, biochemical, and analytical techniques:

  • Mutation Design Strategy:

    • Target conserved residues identified through sequence alignment with human and S. cerevisiae orthologs

    • Focus on residues in substrate binding regions or catalytic domains

    • Create both point mutations for structure-function analysis and truncations to study domain functions

  • Complementation System:

    • Use S. pombe or S. cerevisiae strains with endogenous ERG9 under a repressible promoter

    • Transform with plasmids expressing mutant versions of S. pombe ERG9

    • Assess growth under repressing conditions to determine functional complementation

  • Sterol Profiling:

    • Extract total sterols using established protocols (typically involving saponification followed by organic extraction)

    • Analyze using gas chromatography-mass spectrometry (GC-MS) or liquid chromatography-mass spectrometry (LC-MS)

    • Identify and quantify ergosterol and sterol intermediates to determine pathway blocks or alterations

  • Enzyme Activity Assays:

    • For in vitro analysis, prepare microsomes from cells expressing wild-type or mutant enzymes

    • Measure squalene synthase activity using radiolabeled substrates or coupled spectrophotometric assays

    • Determine kinetic parameters (Km, Vmax) to assess the impact of mutations on catalytic efficiency

  • Phenotypic Characterization:

    • Assess growth under various conditions (temperature, stress, carbon source)

    • Analyze membrane integrity using dyes like propidium iodide

    • Examine resistance/sensitivity to sterol biosynthesis inhibitors or antifungal drugs

Combining these approaches provides comprehensive insights into how specific mutations affect enzyme function, sterol composition, and cellular physiology, advancing understanding of structure-function relationships in squalene synthase.

How do the genetic interactions of ERG9 in S. pombe compare to those in other model organisms?

Factors that might contribute to differences in ERG9 genetic interactions include:

  • Differences in gene duplication patterns

  • Variations in sterol uptake capabilities

  • Different stress response mechanisms

  • Distinct cell cycle control systems

  • Variations in membrane composition requirements

A comprehensive comparative analysis would involve systematic mapping of ERG9 genetic interactions in multiple species using standardized methodologies and analytical frameworks, allowing for identification of core conserved interactions versus species-specific network features.

How has the function of Squalene synthase evolved across different yeast species?

The evolution of squalene synthase function across yeast species reveals a pattern of core functional conservation with species-specific adaptations. Squalene synthase remains dedicated to catalyzing the first committed step in sterol biosynthesis across all eukaryotes, reflecting the fundamental importance of sterols for membrane function . The enzyme's catalytic mechanism appears highly conserved, as evidenced by the ability of S. pombe squalene synthase to functionally replace the S. cerevisiae enzyme in complementation studies .

Species-specific adaptations might include:

  • Different responses to oxygen availability

  • Varied capabilities for exogenous sterol uptake and utilization

  • Distinct feedback regulation mechanisms

  • Different integration with other metabolic pathways

Of particular interest is the observation that some pathogenic yeasts like Candida glabrata can compensate for squalene synthase inhibition by incorporating exogenous sterols, suggesting an evolved adaptation potentially relevant for pathogenesis . Comparative genomic analysis coupled with functional studies across multiple yeast species would provide deeper insights into how squalene synthase function has been conserved or modified throughout evolutionary history.

How should researchers interpret conflicting data about ERG9 regulation in different experimental systems?

Researchers confronted with conflicting data about ERG9 regulation should employ a systematic approach to reconciliation and interpretation. Discrepancies may arise from genuine biological differences between experimental systems or from technical variables in experimental design. When facing such conflicts, consider the following framework:

  • Contextual Differences Assessment:

    • Compare growth conditions (media composition, oxygenation, temperature)

    • Evaluate genetic backgrounds of strains used (wild-type vs. laboratory strains)

    • Consider developmental stage or growth phase differences

  • Methodological Evaluation:

    • Assess sensitivity and specificity of different measurement techniques

    • Compare direct (e.g., ChIP) vs. indirect (e.g., reporter assays) measurements

    • Evaluate time-scale differences in measurements (transient vs. steady-state responses)

  • Data Integration Approaches:

    • Use computational modeling to identify parameters that might explain discrepancies

    • Perform meta-analysis across studies when sufficient data is available

    • Design experiments specifically to test hypotheses that might resolve conflicts

  • Biological Interpretation Strategies:

    • Consider that ERG9 regulation may be multi-layered with redundant mechanisms

    • Evaluate whether conflicting results reflect different aspects of a complex regulatory network

    • Assess whether differences represent species-specific adaptations when comparing across organisms

A concrete example comes from differences observed between in vitro and in vivo studies. In Candida glabrata, ERG9 depletion decreased viability in laboratory media but had no effect on growth in mice due to cholesterol uptake from serum . This apparent conflict was resolved by recognizing the different sterol availability contexts, leading to important insights about sterol uptake mechanisms and their implications for antifungal development.

What statistical approaches are most appropriate for analyzing ERG9 expression data across different experimental conditions?

Selecting appropriate statistical approaches for analyzing ERG9 expression data requires consideration of experimental design, data distribution, and research questions. The following statistical methods are recommended based on common experimental scenarios:

  • For Comparing Expression Across Multiple Conditions:

    • Analysis of Variance (ANOVA) followed by appropriate post-hoc tests (Tukey's HSD, Dunnett's test) for normally distributed data

    • Kruskal-Wallis test followed by Dunn's test for non-normally distributed data

    • Include corrections for multiple testing (Bonferroni, Benjamini-Hochberg) when performing numerous comparisons

  • For Time-Course Expression Analysis:

    • Repeated measures ANOVA or mixed-effects models to account for within-subject correlations

    • Functional data analysis for high-resolution time courses

    • Time-series analysis for identifying periodic patterns or delayed responses

  • For Genetic Interaction Analysis:

    • Correlation-based metrics (Pearson or Spearman) for assessing similarity between genetic profiles

    • Hierarchical clustering to identify genes with similar interaction patterns

    • Principal Component Analysis (PCA) to reduce dimensionality and identify major sources of variation

  • For Integration with Other Data Types:

    • Network analysis methods to integrate expression with protein-protein interaction data

    • Machine learning approaches (Random Forest, Support Vector Machines) for predictive modeling

    • Bayesian networks for causal inference

When analyzing data across species (e.g., comparing S. pombe and S. cerevisiae), normalization methods that account for global differences in expression levels or variance are essential. Additionally, meta-analysis techniques can be valuable for combining evidence across studies with different experimental designs or measurement platforms.

What emerging technologies could advance our understanding of S. pombe ERG9 function and regulation?

Several emerging technologies hold promise for advancing our understanding of S. pombe ERG9 function and regulation:

  • CRISPR-Based Technologies:

    • CRISPRi/CRISPRa for precise transcriptional modulation without genetic modification

    • Base editing for introducing specific mutations without double-strand breaks

    • Prime editing for precise genomic modifications

    • These approaches enable studying essential genes like ERG9 without lethal disruptions

  • Single-Cell Analysis Technologies:

    • Single-cell RNA-seq to reveal cell-to-cell variability in ERG9 expression

    • Single-cell proteomics to detect differences in protein levels

    • Microfluidic approaches for tracking individual cell responses to perturbations

    • These methods can uncover population heterogeneity and stochastic expression patterns

  • Advanced Imaging Techniques:

    • Super-resolution microscopy for detailed localization studies

    • FRET/FLIM for studying protein-protein interactions in vivo

    • Correlative light and electron microscopy to connect protein localization with cellular ultrastructure

    • These approaches provide spatial context for understanding enzyme function

  • Multi-Omics Integration:

    • Combined analysis of transcriptomics, proteomics, lipidomics, and metabolomics data

    • Network-based computational approaches for integrating diverse data types

    • Machine learning algorithms for pattern recognition across complex datasets

    • These integrative approaches provide system-level understanding of ERG9's role

  • Structural Biology Advances:

    • Cryo-EM for membrane protein structure determination without crystallization

    • Hydrogen-deuterium exchange mass spectrometry for mapping protein dynamics

    • AlphaFold and other AI-based structural prediction tools

    • These methods can reveal mechanistic details of substrate binding and catalysis

Combining these technologies will enable unprecedented insights into how ERG9 functions within the complex cellular environment, its regulatory mechanisms, and its interactions with other cellular components.

What are the potential applications of engineered S. pombe ERG9 variants in biotechnology?

Engineered S. pombe ERG9 variants offer several promising applications in biotechnology:

  • Bioproduction of Terpenoids and Steroids:

    • Creating attenuated ERG9 variants can redirect carbon flux from sterol biosynthesis to other terpenoid pathways

    • Fine-tuning ERG9 activity could optimize production of pharmaceutically important compounds like artemisinin precursors or taxol-related molecules

    • Engineered enzymes with altered substrate specificity could produce novel terpenoid structures

  • Antifungal Drug Development Platforms:

    • Humanized S. pombe strains expressing human squalene synthase could serve as screening platforms for selective inhibitors

    • Chimeric enzymes with domains from pathogenic fungi could facilitate selective antifungal development

    • Reporter systems based on ERG9 regulation could identify compounds that disrupt sterol homeostasis

  • Membrane Engineering Applications:

    • Controlled modulation of ERG9 activity could alter sterol composition and membrane properties

    • Engineered cells with custom membrane characteristics could improve bioproduction of membrane proteins

    • Designed sterol profiles could enhance cellular resistance to environmental stresses or industrial conditions

  • Biosensors and Detection Systems:

    • ERG9 promoter-based reporter systems could serve as biosensors for compounds affecting sterol metabolism

    • Such biosensors could be valuable for environmental monitoring or detecting bioactive compounds in natural product extracts

    • Coupling with fluorescent proteins or luciferase would enable high-throughput screening applications

  • Metabolic Engineering Strategies:

    • Understanding ERG9 regulation can inform broader metabolic engineering approaches

    • Knowledge of transcription factor binding sites could enable design of synthetic promoters with desired expression characteristics

    • Integration with genome-scale metabolic models could predict optimal intervention points for desired phenotypes

The development of these applications requires overcoming challenges related to protein stability, expression optimization, and pathway balancing, but advances in synthetic biology and protein engineering continue to expand the toolbox available for such efforts.

What are common challenges in expressing recombinant S. pombe ERG9 and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant S. pombe ERG9, each requiring specific troubleshooting approaches:

  • Low Expression Levels:

    • Challenge: Membrane proteins like squalene synthase often express poorly in heterologous systems.

    • Solutions:

      • Optimize codon usage for the host organism

      • Test different promoters (constitutive vs. inducible)

      • Use fusion partners known to enhance expression (MBP, SUMO)

      • Lower expression temperature to improve folding

      • Consider specialized expression hosts designed for membrane proteins

  • Protein Misfolding and Aggregation:

    • Challenge: Improper folding leading to inclusion body formation or degradation.

    • Solutions:

      • Co-express molecular chaperones to assist folding

      • Use slow induction protocols with lower inducer concentrations

      • Test truncated constructs removing the membrane-spanning domain

      • Add stabilizing agents to growth media (glycerol, specific lipids)

      • Screen different detergents for solubilization

  • Poor Membrane Integration:

    • Challenge: Inefficient targeting to membranes in heterologous systems.

    • Solutions:

      • Ensure C-terminal membrane anchor is intact

      • Consider using homologous expression systems (yeast)

      • Test different signal sequences if using secretory expression

      • Verify localization using fluorescent tags or fractionation studies

  • Inactive Enzyme:

    • Challenge: Protein expresses but lacks enzymatic activity.

    • Solutions:

      • Verify integrity of catalytic domains through sequencing

      • Ensure proper post-translational modifications are present

      • Test enzyme in appropriate lipid environment

      • Optimize buffer conditions (pH, salt, cofactors)

      • Consider protein purification conditions that might be denaturing

  • Purification Difficulties:

    • Challenge: Obtaining pure, homogeneous protein.

    • Solutions:

      • Screen multiple detergents systematically

      • Use affinity tags positioned to avoid interference with function

      • Consider nanodiscs or amphipols for maintaining native-like environment

      • Implement multi-step purification strategy

      • Use size exclusion chromatography as final step

Maintaining detailed records of all optimization attempts and systematically varying one parameter at a time will help identify optimal conditions for successful recombinant expression of S. pombe ERG9.

How can researchers troubleshoot inconsistent results in ERG9 inhibition studies?

When facing inconsistent results in ERG9 inhibition studies, researchers should systematically evaluate multiple factors that could contribute to variability:

  • Inhibitor-Related Factors:

    • Stability: Test inhibitor stability under experimental conditions using analytical methods (HPLC, MS)

    • Solubility: Verify inhibitor remains soluble throughout the experiment and optimize vehicle composition

    • Purity: Confirm batch-to-batch consistency using analytical techniques

    • Binding specificity: Use control compounds to distinguish specific vs. non-specific effects

  • Cellular Uptake Variables:

    • Cell wall/membrane differences: Cell wall thickness varies with growth phase and can affect inhibitor penetration

    • Efflux pumps: Expression of drug efflux transporters may vary between strains or conditions

    • Growth phase: Standardize culture density and growth phase when applying inhibitors

    • Media components: Serum or specific lipids may bind inhibitors or provide alternative sterols

  • Assay-Specific Considerations:

    • Endpoint selection: Different readouts (growth, ergosterol levels, intermediate accumulation) may show different sensitivities

    • Timing: Establish appropriate time points based on inhibitor mechanism and cellular response kinetics

    • Measurement methods: Validate analytical methods for detecting sterols and intermediates

    • Data normalization: Use appropriate internal standards and normalization approaches

  • Strain-Specific Responses:

    • Genetic background: Different S. pombe strains may have varying sensitivity to ERG9 inhibition

    • Compensatory mechanisms: Upregulation of ERG9 or alternative pathways may vary between experiments

    • Sterol uptake capacity: Ability to utilize exogenous sterols might differ between strains

    • Pre-existing mutations: Validate wild-type status of sterol pathway genes in experimental strains

  • Experimental Design Improvements:

    • Include positive controls (known inhibitors like zaragozic acid)

    • Perform dose-response curves rather than single-point measurements

    • Use multiple, complementary assays to confirm effects

    • Implement blinding and randomization to reduce experimental bias

    • Include biological and technical replicates with appropriate statistical analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.