Recombinant Schizosaccharomyces pombe Sterol regulatory element-binding protein 1 (sre1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Schizosaccharomyces pombe Sterol Regulatory Element-Binding Protein 1 (Sre1)

Sterol Regulatory Element-Binding Protein 1 (Sre1) in Schizosaccharomyces pombe is a transcription factor crucial for maintaining lipid homeostasis and regulating the response to low oxygen conditions . Sre1 belongs to the SREBP family, which are master regulators of cellular lipid metabolism .

Functional Overview of Sre1

  1. Regulation of Lipid Homeostasis: Sre1 controls the transcription of genes involved in sterol biosynthesis, ensuring proper levels of ergosterol, an essential sterol in yeast .

  2. Oxygen Sensing: Sre1 indirectly measures oxygen availability through oxygen-dependent sterol synthesis. Under low oxygen conditions, Sre1 activates genes required for adaptation to hypoxia .

  3. Anaerobic Gene Expression: Sre1 is a principal regulator of anaerobic gene expression, controlling a significant portion of genes induced under anaerobic conditions .

Activation and Regulation Mechanism

  1. Sre1-Scp1 Complex: Sre1 functions in complex with Scp1, a protein homologous to mammalian Scap (SREBP cleavage-activating protein) . Scp1 binds and stabilizes Sre1 in the endoplasmic reticulum (ER) membrane .

  2. ER to Golgi Transport: Under low sterol or low oxygen conditions, Scp1 escorts Sre1 from the ER to the Golgi apparatus .

  3. Proteolytic Cleavage: In the Golgi, Sre1 is proteolytically cleaved to release the active N-terminal transcription factor fragment (Sre1N) . This process requires the Dsc E3 ubiquitin ligase complex and the proteasome .

  4. Nuclear Translocation and Transcriptional Activation: After release, Sre1N enters the nucleus and promotes the transcription of sterol synthesis and oxygen-responsive genes . It also up-regulates its own expression through a positive feedback loop .

Role of Ergosterol

Ergosterol, a sterol synthesized in yeast, plays a crucial role in regulating Sre1 activity . Sre1-Scp1 senses ergosterol levels in the endoplasmic reticulum . A quantitative relationship exists between ergosterol concentration and Sre1 activation, where low ergosterol levels trigger Sre1 activation to enhance sterol synthesis .

Coordinate Regulation with Mga2

Sre1 is coordinately regulated with another transcription factor, Mga2, which regulates triacylglycerol and glycerophospholipid synthesis . Sre1 cleavage is affected by Mga2 activity, linking sterol synthesis to fatty acid synthesis .

Sre1 Homolog in Botrytis cinerea

A homolog of Sre1 is found in the fungus Botrytis cinerea, where it regulates development, pathogenicity, and adaptation to host tissue environments . Deletion of SRE1 in B. cinerea results in reduced conidiation, increased sclerotium production, and decreased ergosterol biosynthesis .

Sre1 in Xanthophyllomyces dendrorhous

In Xanthophyllomyces dendrorhous, Sre1 regulates genes in the mevalonate pathway and ergosterol biosynthesis . Mutation of SRE1 reduces sterol and carotenoid production, while overexpression of the Sre1 N-terminal domain increases carotenoid production .

Sre1 and Hypoxia Adaptation

Sre1 is crucial for adaptation to hypoxia . Under low oxygen conditions, Sre1 is activated to promote the transcription of genes involved in sterol synthesis and other oxygen-responsive genes . In B. cinerea, deletion of SRE1 leads to abnormal germination and reduced growth under low-oxygen conditions .

Sre1 and Sclerotium Production

Sre1 negatively mediates sclerotium production in Botrytis cinerea . Deletion of SRE1 results in a significant increase in the number of sclerotia produced .

Conidiation

Sre1 is essential for conidiation in Botrytis cinerea . Deletion of SRE1 drastically reduces the production of conidia .

Tables of Research Findings

FeatureSre1 FunctionReference
Lipid HomeostasisRegulates sterol biosynthesis
Oxygen SensingActivates genes under low oxygen conditions
Anaerobic Gene ExpressionControls genes induced under anaerobic conditions
Ergosterol RegulationSenses and responds to ergosterol levels
Scp1 InteractionForms complex with Scp1 for ER-Golgi transport
Proteolytic CleavageRequires Dsc E3 ubiquitin ligase complex and proteasome for activation
B. cinerea HomologRegulates development, pathogenicity, and hypoxia adaptation
X. dendrorhousRegulates genes in the mevalonate pathway and carotenoid production
AspectΔsre1 Phenotype in B. cinereaWild-Type Phenotype in B. cinerea
ConidiationReduced to 3%Normal
Sclerotium ProductionIncreased six-foldNormal
Ergosterol ContentReduced by halfNormal
Hypoxia AdaptationAbnormal germination/growthNormal germination/growth
Imidazole ResistanceIncreasedNormal

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
sre1; SPBC19C2.09; Sterol regulatory element-binding protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
sre1
Target Protein Sequence
MQSSIPSVSVSVASPAMETPTKASPDSKSPNSVGAIPSSSPLASSTKASTSTPFVENCSN LLCDLASIVEDSPPTLTNTSLSPHSFSLSDMESSMSNWLNPFAFDNTMNSAPPLFTSTNM GSPNSLENSTNPLLSNCGSPNSFQNETFTGPSLNEFDADDKIQRQMKILHSVDTIDPSTV QNYPSADMSNPEVKLKTEEIITPMDTTCKPEPSAKKIKLSPSSEDSCSIPETLPFSAPKS RGSLSPSETPDFVAGPGGKPKKTAHNMIEKRYRTNLNDRICELRDAVPSLRAAAALRCGN SLDDEDLGGLTPARKLNKGTILAKATEYIRHLEAKNKELQKTNKQLSDRLAFYEDPSMAP PSNDTRAVNSVNVVSSSDYSVHQSSRPNLTQRAFTSPTLNTMGRTAL
Uniprot No.

Target Background

Function

Sterol regulatory element-binding protein 1 (Sre1) precursor is a membrane-bound protein residing within the endoplasmic reticulum. Under conditions of low oxygen or sterol levels, it undergoes processing, releasing the transcription factor form which translocates to the nucleus. This active form then initiates transcription of genes crucial for anaerobic growth adaptation, encompassing pathways involved in sterol, heme, sphingolipid, and ubiquinone biosynthesis. Sre1 may function as an oxygen sensor through its involvement in oxygen-requiring sterol synthesis steps.

Gene References Into Functions
  1. Sre1 and Mga2 exhibit reciprocal regulation through their respective lipid pathway products, coordinating lipid synthesis pathways. PMID: 28202541
  2. In vitro reconstitution and crystal structure analysis of the Sre1-Scp1 complex and the Scp1 WD40 domain (2.1 Å resolution) have been reported. PMID: 25771684
  3. Hhp2, a casein kinase 1 family member, has been identified as a novel Sre1N regulator. PMID: 24327658
  4. Ofd1 prolyl hydroxylase downregulates Sre1N activity by inhibiting DNA binding and accelerating its degradation in the presence of oxygen. PMID: 22833559
  5. Sre1p is a key activator of anaerobic gene expression, upregulating genes involved in nonrespiratory oxygen consumption. PMID: 16537923
  6. The Ofd1 dioxygenase domain serves as an oxygen sensor, regulating Nro1-Ofd1 interaction and controlling oxygen-dependent Sre1N stability. PMID: 19158663
  7. Scp1-independent Sre1 degradation involves the ER-associated degradation (ERAD) components Ubc7 (E2 ubiquitin conjugating enzyme) and Hrd1 (E3 ubiquitin ligase). PMID: 19520858
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 1]: Nucleus.

Q&A

What is the basic structure of Sre1 in S. pombe and how does it compare to other organisms?

Sre1 in S. pombe is synthesized as an inactive transmembrane protein anchored to the endoplasmic reticulum (ER). It contains an N-terminal domain with a basic helix-loop-helix (bHLH) leucine zipper DNA binding motif facing the cytoplasm. The protein has two transmembrane segments and a C-terminal regulatory domain that interacts with SCAP (known as Scp1 in fungi). Compared to homologs in other fungi like X. dendrorhous, the S. pombe Sre1 has distinctive features such as the conserved tyrosine residue in the bHLH motif, an N-terminal domain rich in serine and proline residues, and the two characteristic transmembrane helices after the bHLH motif . When studying recombinant Sre1, it's important to note that some organisms like X. dendrorhous have Sre1 proteins with shorter C-terminal domains and lack the DUF2014 domain present in other SREBPs, which may indicate different activation mechanisms .

How does Sre1 activation occur in S. pombe?

Sre1 activation in S. pombe follows a sterol-dependent regulatory pathway. Under normal conditions, the Sre1-Scp1 complex remains anchored to the ER membrane through interaction with sterols. When cellular sterol levels decrease, the Sre1-Scp1 complex is transported to the Golgi apparatus where Sre1 undergoes proteolytic cleavage, releasing the transcriptionally active N-terminal domain (Sre1N). This cleaved form then translocates to the nucleus to regulate target gene expression . The activation mechanism differs from some other fungi; for example, while S. pombe has an INSIG encoding gene homolog, its deletion doesn't affect Sre1 activation unlike in mammalian systems . Experimental approaches to study activation typically involve creating sterol-depleted conditions through genetic manipulations or pharmacological inhibitors of sterol biosynthesis.

What are the primary transcriptional targets of Sre1 in S. pombe?

In S. pombe, Sre1N primarily activates the transcription of genes involved in three main pathways: sterol biosynthesis, lipid metabolism, and hypoxic response . Specific targets include genes in the mevalonate pathway and genes involved in ergosterol biosynthesis. Experimental identification of these targets typically employs chromatin immunoprecipitation (ChIP) followed by PCR or sequencing, as well as RNA-seq analysis comparing wild-type and sre1- mutant strains. Research has shown that genes with Sterol Regulatory Elements (SREs) in their promoter regions are direct targets of Sre1 binding, with the mevalonate pathway genes HMGS and HMGR being well-characterized examples in various organisms . To experimentally validate Sre1 targets, researchers often use both in vitro approaches like Electrophoretic Mobility Shift Assays (EMSA) and in vivo methods like ChIP-PCR to confirm direct binding to promoter regions.

How can recombinant Sre1 be expressed and purified for in vitro studies?

For recombinant expression of S. pombe Sre1, researchers typically clone the N-terminal domain (containing the bHLH motif) into bacterial expression vectors. Expression in E. coli BL21(DE3) strain with a 6xHis tag allows for efficient purification using nickel affinity chromatography. When expressing full-length Sre1, which contains transmembrane domains, eukaryotic expression systems such as insect cells or yeast may provide better results for proper protein folding. Purification protocols often include:

  • Cell lysis using sonication in buffer containing protease inhibitors

  • Clarification by centrifugation (20,000 g, 30 min)

  • Binding to Ni-NTA resin

  • Washing with increasing imidazole concentrations

  • Elution with high imidazole buffer (250-300 mM)

  • Dialysis to remove imidazole

For functional studies of the DNA-binding capability, EMSA assays can be performed using purified Sre1N and DNA fragments containing SRE sequences . This approach has been successfully used to demonstrate that the bHLH domain of Sre1 binds specifically to SRE sequences in vitro, confirming its function as a transcription factor.

What genetic approaches are most effective for studying Sre1 function in vivo?

Several genetic approaches have proven effective for investigating Sre1 function in S. pombe:

  • Gene deletion (sre1-): Complete knockout of Sre1 allows researchers to identify phenotypes and compare gene expression profiles between wild-type and mutant strains. This approach revealed that Sre1 is essential for growth under anaerobic conditions and in the presence of cobalt chloride (a hypoxia-mimicking agent) .

  • Domain-specific mutants: Expressing only the N-terminal domain (Sre1N) creates a constitutively active transcription factor, allowing the study of target gene activation independent of sterol levels.

  • Promoter replacement: Replacing the native Sre1 promoter with regulatable promoters enables controlled expression.

  • Epitope tagging: Adding tags like FLAG or HA facilitates ChIP experiments to identify DNA-binding sites.

  • Point mutations: Creating specific mutations in functional domains helps elucidate structure-function relationships.

  • Complementation assays: Testing if S. pombe Sre1 can restore function in sre1- mutants from other species provides insights into evolutionary conservation .

A particularly informative approach involves RNA-seq analysis comparing gene expression profiles between wild-type, sre1-, and Sre1N-expressing strains to identify direct and indirect Sre1 targets, as demonstrated in research with X. dendrorhous .

What phenotypic assays are most informative for characterizing Sre1 mutants?

The most informative phenotypic assays for characterizing Sre1 mutants in S. pombe include:

  • Growth under hypoxic conditions: S. pombe sre1- mutants cannot grow under anaerobic conditions, making this a definitive assay for Sre1 functionality .

  • Cobalt chloride sensitivity: Growth inhibition in the presence of CoCl₂ (a hypoxia-mimicking agent) is characteristic of sre1- mutants .

  • Azole resistance: Sre1 is essential for growth in the presence of inhibitors of ergosterol synthesis such as azoles, making azole sensitivity a useful phenotypic marker .

  • Sterol profiling: Quantitative analysis of sterols using gas or liquid chromatography coupled with mass spectrometry reveals alterations in sterol biosynthesis in sre1 mutants.

  • Gene expression analysis: RT-qPCR of known Sre1 targets like HMGS and HMGR provides a molecular phenotype assessment .

  • Cell wall integrity assays: Since Sre1 indirectly affects cell wall composition, assays using cell wall-disrupting agents like Calcofluor White can be informative.

These assays collectively provide a comprehensive characterization of Sre1 function in cellular physiology and sterol homeostasis.

How does Sre1 interact with other signaling pathways in S. pombe?

Sre1 in S. pombe interacts with multiple signaling pathways, creating a complex regulatory network. Research has revealed several key interactions:

  • Rho GTPase signaling: While not directly shown for Sre1, S. pombe protein kinase C homologues (pck1p and pck2p) interact with rho1p and rho2p GTPases in their GTP-bound forms. These interactions occur at the amino-terminal region containing HR1 motifs, stabilizing the kinases . Given that both pathways affect cell wall integrity, cross-talk is likely.

  • Ras/Ral signaling: Evidence suggests functional links between pck1+ and the ras1+ and ral1+ pathways . Since Sre1 regulates sterol metabolism which affects membrane properties where Ras proteins function, these pathways may influence each other.

  • Cell integrity pathways: The maintenance of cell integrity in S. pombe involves multiple factors, with 20 factors required for donor selection in mating-type switching having been identified . These pathways may overlap with Sre1 functions, particularly under stress conditions.

To experimentally investigate these interactions, researchers typically use genetic approaches such as creating double mutants (e.g., sre1- combined with mutations in other signaling components) and performing epistasis analysis to determine the hierarchy of gene functions.

What is the relationship between Sre1 activation and hypoxic response?

Sre1 plays a central role in the hypoxic response in S. pombe, similar to its homologs in other fungi like C. neoformans and A. fumigatus. The relationship between Sre1 activation and hypoxic response involves several key mechanisms:

  • Oxygen-dependent regulation: Oxygen is required for ergosterol biosynthesis, and under hypoxic conditions, sterol levels decrease, triggering Sre1 activation.

  • Hypoxia-specific phenotypes: S. pombe sre1- mutants are unable to grow under anaerobic conditions or in the presence of cobalt chloride, a chemical that mimics hypoxia . This phenotype can be rescued by complementation with the native gene, confirming Sre1's essential role in hypoxic adaptation.

  • Transcriptional regulation: Under hypoxic conditions, activated Sre1N upregulates genes involved in oxygen-dependent processes, particularly sterol biosynthesis, to maintain cellular functions despite limited oxygen availability.

  • Adaptation mechanisms: The Sre1 pathway allows cells to adapt to low oxygen by modifying membrane composition and metabolic pathways to optimize oxygen utilization.

Experimentally, the relationship between Sre1 and hypoxia can be studied using controlled oxygen conditions in bioreactors, chemical hypoxia mimics like cobalt chloride , and comparative transcriptomics of wild-type and sre1- strains under various oxygen tensions.

How do post-translational modifications regulate Sre1 activity?

Post-translational modifications (PTMs) play critical roles in regulating Sre1 activity, though specific details for S. pombe Sre1 are still being elucidated. Based on the available research and knowledge from related systems:

  • Proteolytic processing: The primary regulatory mechanism involves proteolytic cleavage of Sre1 in the Golgi apparatus, releasing the active N-terminal domain (Sre1N) . This process is regulated by sterol levels and requires the SCAP homolog Scp1.

  • Protein stability regulation: The GTP-bound form of Rho1p dramatically stabilizes protein kinases in S. pombe , suggesting that similar mechanisms might affect Sre1 stability, particularly since both pathways are involved in cell wall integrity.

  • Phosphorylation: While not explicitly demonstrated for S. pombe Sre1 in the provided search results, studies in other systems suggest that phosphorylation of the N-terminal domain can affect DNA binding activity, nuclear localization, and protein stability.

  • Ubiquitination: The search results mention the H2B ubiquitin ligase HULC and the BRE1-like ubiquitin ligase Brl2 as being involved in processes related to Sre1 function , suggesting potential regulation through ubiquitination pathways.

To study these modifications experimentally, researchers typically use mass spectrometry-based proteomics, phospho-specific antibodies, and genetic approaches targeting specific modifying enzymes.

How can chromatin immunoprecipitation be optimized for studying Sre1 binding sites genome-wide?

Optimizing ChIP protocols for genome-wide Sre1 binding site identification requires careful consideration of several factors:

Research has demonstrated that Sre1 binds directly to SRE sequences in target gene promoters, as validated by both in vitro EMSA assays and in vivo ChIP-PCR for genes like HMGS .

What techniques can resolve contradictory findings regarding Sre1 target genes across different experimental systems?

Resolving contradictory findings regarding Sre1 target genes requires a multi-faceted approach that addresses variability in experimental systems:

  • Standardized experimental conditions: Establish consistent growth conditions, particularly regarding oxygen levels and sterol content, which significantly affect Sre1 activation.

  • Integrative genomic approaches:

    • Combine ChIP-seq data with RNA-seq from wild-type and sre1- strains

    • Use time-course experiments to distinguish primary from secondary effects

    • Apply network analysis to identify direct versus indirect regulation

  • Validation through multiple techniques:

    • Confirm binding with both in vitro (EMSA) and in vivo (ChIP-PCR) methods

    • Verify transcriptional effects using reporter assays

    • Perform mutagenesis of putative binding sites to establish causality

  • Cross-species comparisons: Compare Sre1 targets across related fungi with careful normalization for evolutionary distance. For example, research has shown differential roles of Sre1 between S. pombe, where it primarily regulates sterol biosynthesis and hypoxic response, and X. dendrorhous, where it additionally regulates carotenoid biosynthesis .

  • Biological context consideration: Account for strain background differences, growth phase, and stress conditions that may alter the Sre1 regulon.

A particularly effective approach is to create a "consensus regulon" by identifying genes that respond to Sre1 across multiple experimental systems and validation methods, as demonstrated by comparative analysis between S. pombe and other fungi .

How does the function of Sre1 in S. pombe compare with homologs in pathogenic fungi, and what are the implications for antifungal development?

Comparative analysis of Sre1 between S. pombe and pathogenic fungi reveals important similarities and differences with significant implications for antifungal development:

OrganismSre1 NomenclatureKey FunctionsResponse to AzolesEssential for Virulence
S. pombeSre1Sterol homeostasis, Hypoxic adaptationRequired for azole resistanceN/A (non-pathogenic)
C. neoformansSre1Sterol biosynthesis, Hypoxic growthContributes to resistanceYes
A. fumigatusSrbAErgosterol biosynthesis, Hypoxic growthCritical for resistanceYes (null mutants avirulent in mouse models)
X. dendrorhousSre1Sterol and carotenoid biosynthesisNot fully characterizedN/A (non-pathogenic)

Key functional differences and research implications:

  • Conservation of core mechanism: The basic activation mechanism involving sterol-dependent processing appears conserved, but with variations in the processing machinery. For instance, some fungi like X. dendrorhous may lack SCAP and INSIG components .

  • Domain variations: Differences in the C-terminal domain, such as the absence of the DUF2014 domain in X. dendrorhous Sre1 , suggest divergent regulatory mechanisms that could be exploited for species-specific targeting.

  • Regulatory network differences: While the core targets in sterol biosynthesis are conserved, species-specific targets exist, such as carotenoid biosynthesis genes in X. dendrorhous .

  • Antifungal implications:

    • Sre1 activation is essential for resistance to azole antifungals across multiple species

    • Inhibitors targeting Sre1 activation could sensitize resistant fungi to existing antifungals

    • Differences in activation mechanisms between species could be exploited for selective targeting

    • The essentiality of Sre1 for virulence in pathogenic species makes it an attractive drug target

Research approaches to exploit these differences include structural biology studies to identify unique binding sites in pathogen-specific Sre1 proteins, high-throughput screening for inhibitors of Sre1 activation, and combination therapy approaches targeting both Sre1 and ergosterol biosynthesis.

What are the key challenges in creating stable recombinant Sre1 constructs, and how can they be overcome?

Creating stable recombinant Sre1 constructs presents several challenges due to the protein's membrane association and complex regulatory mechanisms. Common issues and solutions include:

  • Protein instability: The full-length Sre1 protein is inherently unstable, particularly when separated from its membrane environment. This can be addressed by:

    • Working with just the N-terminal domain (Sre1N) for transcription factor studies

    • Using fusion tags that enhance stability (e.g., MBP or SUMO tags)

    • Including protease inhibitors throughout purification

    • Expressing in eukaryotic systems rather than bacterial systems

  • Transmembrane domain complications: The presence of transmembrane domains makes expression and purification challenging. Solutions include:

    • Using detergent solubilization (e.g., DDM or CHAPS) during extraction

    • Creating chimeric constructs with more stable transmembrane domains

    • Employing nanodiscs or liposomes to maintain membrane environment

  • Post-translational modifications: If studying the regulation of Sre1, key modifications may be missing in heterologous systems. This can be addressed by:

    • Using S. pombe or similar yeasts as expression hosts

    • Co-expressing key modifying enzymes

    • Employing site-directed mutagenesis to mimic phosphorylation states

  • Expression toxicity: Constitutively active Sre1N may be toxic to expression hosts. Solutions include:

    • Using tightly controlled inducible promoters

    • Short induction times with lower temperatures

    • Screening for non-toxic mutants that retain functionality

The binding of GTP-bound Rho1p to the amino-terminal region of protein kinases dramatically stabilizes these proteins in S. pombe , suggesting that co-expression with appropriate binding partners might similarly enhance Sre1 stability.

How can researchers effectively differentiate between direct and indirect transcriptional effects of Sre1?

Differentiating between direct and indirect Sre1 transcriptional effects requires a multi-faceted approach:

  • Temporal analysis: Direct targets typically show more rapid expression changes after Sre1 activation. Time-course experiments following Sre1 activation (using systems with inducible Sre1N expression) can help separate primary from secondary effects.

  • Motif analysis: Direct targets contain SRE motifs in their promoters. Bioinformatic analysis using tools like TFBIND and JASPAR can identify potential SRE sequences, as demonstrated in studies of X. dendrorhous where these tools successfully identified SRE sequences in genes differentially expressed in sre1- mutants .

  • ChIP experiments: Direct binding of Sre1 to target promoters can be confirmed through ChIP-PCR or ChIP-seq. In research with X. dendrorhous, ChIP-PCR confirmed direct binding of Sre1 to the HMGS gene promoter . Including appropriate negative controls like the grg2 gene, which was confirmed not to be a Sre1 target , is essential.

  • Reporter assays: Testing the ability of wild-type versus mutated promoter sequences to drive reporter gene expression in response to Sre1 activation can confirm direct regulation.

  • In vitro binding assays: EMSA assays using purified Sre1N and promoter fragments can confirm direct binding capability, as demonstrated for SRE sequences from the HMGS promoter .

  • Genetic approach: Creating rapid induction systems where Sre1N activation occurs in the presence of protein synthesis inhibitors can help identify direct targets that don't require new protein synthesis.

A comprehensive approach combining these methods provides the strongest evidence for direct transcriptional regulation by Sre1.

What are the most effective strategies for studying Sre1 function in hypoxic conditions while controlling for secondary effects?

Studying Sre1 function in hypoxic conditions while controlling for secondary effects requires careful experimental design:

  • Controlled hypoxia systems:

    • Use anaerobic chambers with precise oxygen control rather than chemical mimics

    • Implement gradual oxygen reduction to allow adaptive responses

    • Monitor dissolved oxygen continuously in liquid cultures

  • Genetic approaches:

    • Create constitutively active Sre1N mutants to separate Sre1 function from upstream hypoxia sensing

    • Use conditional mutants (temperature-sensitive) to enable temporal control

    • Develop orthogonal systems where Sre1 activity can be chemically induced independent of oxygen levels

  • Distinguishing direct hypoxic effects:

    • Include controls with alternative stressors that don't affect oxygen (e.g., heat shock)

    • Compare transcriptional profiles of hypoxia-stressed wild-type cells versus normoxic cells expressing constitutive Sre1N

    • Use metabolic profiling to distinguish between direct oxygen limitation effects and Sre1-mediated adaptations

  • Controlling for secondary effects:

    • Use short time courses to capture immediate responses before secondary effects emerge

    • Include metabolic supplementation (e.g., ergosterol) to bypass specific pathways

    • Compare sre1- mutants with specific pathway mutants to isolate Sre1-specific functions

  • Pharmacological approaches:

    • Use pathway-specific inhibitors to block secondary effects

    • Compare cobalt chloride (which mimics hypoxia) with true hypoxia to identify overlap

    • Utilize azole antifungals that specifically inhibit ergosterol biosynthesis to separate sterol effects from other hypoxic responses

Research has shown that S. pombe sre1- mutants are unable to grow under anaerobic conditions or in the presence of cobalt chloride, and this growth defect can be restored by complementation with the native gene , providing a clear phenotypic readout for successful experimental designs.

How might high-throughput genetic interaction screens provide new insights into Sre1 regulatory networks?

High-throughput genetic interaction screens offer powerful approaches to uncover new components of Sre1 regulatory networks in S. pombe:

  • Synthetic genetic array (SGA) methodology:

    • Crossing sre1- or constitutively active Sre1N strains with genome-wide deletion libraries

    • Identifying synthetic lethal or synthetic rescue interactions

    • Quantifying genetic interaction strengths to build functional networks

  • CRISPR-based screens in S. pombe:

    • Employing CRISPRi to systematically knock down genes in sre1- backgrounds

    • Using CRISPR activation (CRISPRa) to identify suppressors of sre1- phenotypes

    • Conducting tiled CRISPR screens across the Sre1 locus to identify functional domains

  • Chemical-genetic approaches:

    • Screening for compounds that specifically affect sre1- mutants

    • Identifying genes that, when deleted, alter sensitivity to Sre1-activating conditions

  • Multi-omic integration:

    • Combining genetic interaction data with transcriptomics, proteomics, and metabolomics

    • Constructing predictive models of Sre1 regulation and function

Previous screens have already identified unexpected factors involved in related processes, such as the histone H3K4 methyltransferase complex subunits (Set1, Swd1, Swd2, Swd3, Spf1, and Ash2), the BRE1-like ubiquitin ligase Brl2, and the Elongator complex subunit Elp6 in mating-type switching processes . Similar approaches could reveal unexpected connections to Sre1 function.

A particularly promising direction would be to screen for genetic interactions under specific conditions such as hypoxia or sterol depletion, which would enrich for context-specific factors involved in Sre1 regulation.

What roles might non-coding RNAs play in regulating Sre1 expression and activity?

While the search results don't explicitly discuss non-coding RNAs in Sre1 regulation, this represents an important emerging research direction based on knowledge from related systems:

  • Potential regulatory mechanisms:

    • miRNAs targeting Sre1 mRNA for degradation or translational repression

    • Long non-coding RNAs (lncRNAs) as scaffolds for regulatory protein complexes

    • Antisense transcripts modulating Sre1 expression

    • RNA-binding proteins interacting with Sre1 mRNA to affect stability or translation

  • Experimental approaches to investigate:

    • RNA immunoprecipitation (RIP) to identify RNAs associated with Sre1 or its regulatory proteins

    • Small RNA sequencing of wild-type versus mutant strains under various conditions

    • CRISPR screens targeting annotated non-coding RNAs for effects on Sre1 activity

    • RNA-protein interaction mapping using techniques like CLIP-seq

  • Specific research questions:

    • Do stress-responsive non-coding RNAs modulate Sre1 expression under hypoxia?

    • Are there RNA structures within the Sre1 mRNA that regulate its translation or localization?

    • Could antisense transcription at the Sre1 locus provide regulatory feedback?

    • Do lncRNAs mediate interactions between the Sre1 pathway and other stress response pathways?

The study of non-coding RNAs in S. pombe has been facilitated by the well-annotated genome and powerful genetic tools, making this a feasible avenue for future Sre1 research. Given the complex regulation of Sre1 and its central role in sterol homeostasis and hypoxic adaptation, non-coding RNA involvement would add an important layer to our understanding of its regulation.

How can systems biology approaches integrate multiple datasets to build comprehensive models of Sre1 function?

Systems biology approaches offer powerful frameworks for integrating diverse experimental data into comprehensive models of Sre1 function:

  • Multi-omic data integration:

    • Transcriptomics: RNA-seq data from wild-type, sre1-, and Sre1N-expressing strains under various conditions

    • Proteomics: Mass spectrometry to capture protein levels and post-translational modifications

    • Metabolomics: Profiles of sterols, lipids, and other metabolites affected by Sre1

    • Interactomics: Protein-protein and protein-DNA interaction networks

  • Network modeling approaches:

    • Construct directed regulatory networks with Sre1 as a central node

    • Identify feedback loops and regulatory motifs

    • Incorporate temporal dynamics of Sre1 activation and target gene expression

    • Develop predictive models for cellular responses to environmental changes

  • Computational tools and methodologies:

    • Machine learning to identify patterns in complex datasets

    • Bayesian networks to infer causal relationships

    • Constraint-based modeling to predict metabolic adaptations

    • Agent-based models to simulate cellular behavior under varying conditions

  • Specific research applications:

    • Predicting cellular responses to novel stress conditions

    • Identifying critical nodes for intervention in pathogenic fungi

    • Understanding how Sre1 networks evolved across fungal species

    • Predicting genetic interactions and drug synergies

  • Validation approaches:

    • Test model predictions with targeted experiments

    • Iteratively refine models with new data

    • Compare model predictions across different fungal species

Research has already begun integrating multiple data types, as seen in studies combining RNA-seq analysis with ChIP-PCR and promoter analysis to identify direct Sre1 targets in X. dendrorhous . These approaches revealed that genes of the mevalonate pathway and ergosterol biosynthesis are transcriptional targets of Sre1, and unexpectedly identified regulation of carotenoid biosynthesis as a species-specific function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.