Recombinant Schizosaccharomyces pombe Synembryn-like protein C3E7.04c (SPBC3E7.04c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
SPBC3E7.04c; Synembryn-like protein C3E7.04c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-530
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC3E7.04c
Target Protein Sequence
MELEAYIQSLGLGIESYSQSATQFHDEANQSFNIPISTIIKLKEACRELETSKVVAKSLN WSHLLRVISLLWEKDVSLELMKLLANCLRQVPSISVQIVHNESLKQLTTSVFEVRAPKVL SLISTFNDDLERRVVFMRFLFILLSTQTDDICLDMRQVRTQLIQMLKKMWTLNSSPSNNS QDNEMVLTEILRLLFPISKRSYLKEEDEQKILLLVIEIWASSLNNNPNSPLRWHATNALL SFNLQLLSLDQAIYVSEIACQTLQSILISREVEYLEKGLNLCFDIAAKYQNTLPPILAIL LSLLSFFNIKQNLSMLLFPTNDDRKQSLQKGKSFRCLLLRLLTIPIVEPIGTYYASLLNE LCDGDSQQIARIFGAGYAMGISQHSETMPFPSPLSKAASPVFQKNSRGQENTEENNLAID PITGSMCTNRNKSQRLELSQEEKEREAERLFYLFQRLEKNSTIQVTNPIQQAVNSGFIDV VFCLIFQMSSESFIYHCYHSFVGPIHILLLMFSTFKFHEILHFIKISKAS
Uniprot No.

Target Background

Function

Probable guanine nucleotide exchange factor (GEF).

Database Links
Protein Families
Synembryn family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Synembryn-like protein C3E7.04c and why is it significant in research?

Synembryn-like protein C3E7.04c (SPBC3E7.04c) is a protein encoded in the Schizosaccharomyces pombe genome. This protein is part of the broader class of synembryn-like proteins with potential regulatory functions. Its significance stems from S. pombe's importance as a model organism that resembles human cells in various cellular processes, including mitochondrial inheritance, mitochondrial transport, and sugar metabolism . The protein has a full amino acid sequence of 530 amino acids and contains several functional domains that may contribute to its biological activity . Studying this protein can provide insights into conserved cellular processes between yeast and higher eukaryotes, making it valuable for both fundamental and biomedical research applications.

How is S. pombe utilized as a model organism in protein research?

Schizosaccharomyces pombe (fission yeast) serves as an excellent model organism for protein research due to several key advantages:

  • Cellular similarity: S. pombe shares significant cellular processes with human cells, particularly in mitochondrial inheritance and transport mechanisms .

  • Metabolic relevance: The sugar metabolism pathways in S. pombe resemble those in human cells, making it valuable for metabolic studies .

  • Mitogenome structure: The mitochondrial genome structure is similar to that in humans, featuring the "petite-negative phenotype" where mitochondrial function is essential for viability .

  • Experimental accessibility: A wide range of experimental techniques and genetic manipulation tools have been developed specifically for S. pombe .

  • Database resources: Comprehensive database resources for S. pombe facilitate data analysis and comparison .

These advantages make S. pombe particularly useful for studying conserved proteins like SPBC3E7.04c, enabling researchers to draw parallels to human cellular processes while benefiting from the experimental simplicity of a unicellular organism.

What are the optimal conditions for handling and storing recombinant SPBC3E7.04c protein?

For optimal handling and storage of recombinant SPBC3E7.04c protein, researchers should follow these evidence-based protocols:

Short-term storage (up to one week):

  • Maintain the protein at 4°C in working aliquots .

  • Use a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein .

Long-term storage:

  • Store at -20°C for regular long-term storage .

  • For extended preservation periods, conserve at -80°C to minimize protein degradation .

Critical handling considerations:

  • Avoid repeated freeze-thaw cycles as this can significantly compromise protein integrity and activity .

  • When thawing, do so rapidly at room temperature followed by placement on ice to prevent degradation.

  • Consider adding protease inhibitors to prevent enzymatic degradation during experimental procedures.

Buffer optimization:

  • The Tris-based buffer with 50% glycerol provides stability, but specific experiments may require buffer exchange using dialysis or desalting columns.

  • Document any changes in protein activity after buffer modifications to establish optimal conditions for your specific experimental applications.

How should I design experiments to study SPBC3E7.04c function using true experimental research approaches?

Designing robust experiments to study SPBC3E7.04c function requires careful consideration of experimental research principles:

True Experimental Design Structure:
Implement a posttest-only control group design or pretest-posttest control group design to establish causality in your functional studies :

  • Random Assignment: Divide experimental units (cell cultures or organisms) randomly into treatment and control groups to minimize bias .

  • Control Variables: Maintain strict control over variables such as temperature, culture media, incubation time, and genetic background .

  • Define Dependent Variables: Clearly establish measurable outcomes that reflect protein function (e.g., growth rate, gene expression patterns, protein interaction profiles) .

Experimental Approaches for SPBC3E7.04c:

Experimental ApproachMethodologyExpected OutcomesControls Required
Gene Deletion/KnockoutCRISPR-Cas9 or homologous recombinationPhenotypic changes indicating protein functionWild-type strain, unrelated gene deletion
Protein LocalizationFluorescent tagging (GFP fusion)Subcellular compartment identificationUntagged strain, known localization markers
Protein-Protein InteractionsCo-immunoprecipitation, yeast two-hybridIdentification of interaction partnersEmpty vector controls, non-specific antibody
Functional ComplementationExpression in mutant strainsRescue of phenotypesEmpty vector, inactive protein mutant

When interpreting results, apply quasi-experimental analysis methods when randomization isn't feasible, such as when working with specific mutant strains . Document all experimental conditions thoroughly to ensure reproducibility and facilitate meta-analysis of accumulated data.

What methods are most effective for purifying recombinant SPBC3E7.04c for structural and functional studies?

For optimal purification of recombinant SPBC3E7.04c, a systematic multi-step approach is recommended:

Expression System Selection:

  • For basic studies: E. coli expression systems with T7 promoters can provide high yields.

  • For post-translational modifications: Consider S. pombe or S. cerevisiae expression systems that better replicate native folding and modifications.

Affinity Purification Strategy:
The protein can be expressed with various tags determined during the production process . Common approaches include:

  • His-tag purification: Using immobilized metal affinity chromatography (IMAC) with Ni-NTA or cobalt resins.

  • GST-tag purification: Employing glutathione affinity chromatography for higher solubility.

  • FLAG/MBP-tag approaches: When protein folding or solubility is challenging.

Purification Protocol Framework:

  • Cell lysis optimization:

    • For S. pombe expression: Enzymatic digestion of cell wall followed by mechanical disruption

    • For bacterial expression: Sonication or high-pressure homogenization in Tris buffer with protease inhibitors

  • Sequential chromatography:

    • Capture phase: Affinity chromatography based on selected tag

    • Intermediate phase: Ion-exchange chromatography based on protein's pI

    • Polishing phase: Size-exclusion chromatography for highest purity

  • Quality assessment:

    • SDS-PAGE analysis for purity (aim for >95%)

    • Western blot confirmation of identity

    • Dynamic light scattering for homogeneity

    • Activity assays to confirm functional state

Critical considerations:

  • The protein contains regions that may affect solubility; maintain optimized buffer conditions throughout purification

  • Consider adding stabilizing agents like glycerol (up to 50%) for long-term storage

  • Validate that the purification method doesn't compromise functional activity through comparative enzymatic assays

How does SPBC3E7.04c potentially contribute to mitochondrial function in S. pombe?

While the direct mitochondrial role of SPBC3E7.04c has not been fully characterized in the provided search results, we can analyze its potential contributions based on S. pombe mitochondrial biology:

S. pombe serves as an excellent model for mitochondrial research due to its similarities to human cells in terms of mitochondrial inheritance, transport mechanisms, and mitogenome structure . The mitochondrial gene expression machinery in S. pombe is structurally and functionally conserved compared to humans, making it valuable for studying proteins that may interact with this system .

Potential mitochondrial functions of SPBC3E7.04c:

  • Regulatory roles in transcription: As a synembryn-like protein, SPBC3E7.04c may participate in signaling pathways that regulate mitochondrial gene expression. S. pombe mitochondrial genomes produce polycistronic transcripts that undergo processing via the tRNA punctuation model, suggesting potential regulatory points where this protein might function .

  • Contribution to OXPHOS complex assembly: The protein may play a role in the assembly or regulation of oxidative phosphorylation (OXPHOS) complexes, which are crucial for mitochondrial energy production .

  • Interaction with PPR proteins: Pentatricopeptide repeat (PPR) proteins are important in mitochondrial RNA metabolism. SPBC3E7.04c might function in pathways involving these proteins, affecting mitochondrial translation and gene expression .

To investigate these potential functions, researchers should consider:

  • Subcellular localization studies using fluorescently tagged SPBC3E7.04c

  • Co-immunoprecipitation experiments to identify mitochondrial interaction partners

  • Transcriptomic and proteomic analyses comparing wild-type and SPBC3E7.04c mutant strains

  • Measurements of mitochondrial membrane potential and respiratory capacity in cells with modified SPBC3E7.04c expression

What approaches can be used to investigate evolutionary conservation of SPBC3E7.04c across species?

Investigating the evolutionary conservation of SPBC3E7.04c requires systematic comparative genomics and experimental validation approaches:

Computational Analysis Framework:

  • Sequence Homology Analysis:

    • Perform BLAST searches against comprehensive databases (NCBI, UniProt)

    • Use position-specific scoring matrices to detect distant homologs

    • Construct multiple sequence alignments using MUSCLE or CLUSTAL Omega

    • Calculate sequence identity/similarity percentages across species

  • Domain Architecture Comparison:

    • Identify conserved domains using InterPro, Pfam, or SMART databases

    • Compare domain organization across homologs to detect evolutionary patterns

    • Analyze conservation of key functional residues across species

  • Phylogenetic Analysis:

    • Construct maximum likelihood or Bayesian phylogenetic trees

    • Calculate evolutionary distances between homologs

    • Identify potential gene duplication or horizontal transfer events

Experimental Validation Methods:

ApproachMethodologyExpected OutcomesConsiderations
Cross-species ComplementationExpress homologs in S. pombe SPBC3E7.04c mutantsFunctional rescue indicates conserved functionDifferences in expression systems may affect results
Reciprocal Best Hit AnalysisBidirectional BLAST between genomesIdentification of true orthologs vs. paralogsNeed for complete genome sequences
Synteny AnalysisCompare gene neighborhoods across genomesConservation of genomic context suggests functional relationshipsLimited by quality of genome assemblies
Protein Structure ComparisonStructural alignment of homologsConservation of 3D structure despite sequence divergenceRequires solved structures or reliable models

Interpretation Framework:

  • High sequence conservation suggests essential functions under strong selective pressure

  • Variable regions may indicate species-specific adaptations

  • Conservation of interaction interfaces suggests preserved protein-protein interactions

  • Correlation between conservation patterns and phenotypic effects of mutations can reveal functional domains

This multi-layered approach provides robust evidence for evolutionary relationships and functional conservation, allowing researchers to place SPBC3E7.04c in its proper evolutionary context.

How can I interpret contradictory results in SPBC3E7.04c functional studies?

When confronted with contradictory results in SPBC3E7.04c functional studies, researchers should implement a systematic approach to reconcile discrepancies:

Step 1: Analyze Experimental Design Differences
Using the principles of experimental research design , examine these key factors:

  • Control Groups: Compare the control conditions used across studies. Different reference points can lead to seemingly contradictory interpretations .

  • Experimental Conditions: Variations in temperature, media composition, or growth phase can significantly affect protein function.

  • Genetic Background: S. pombe strain differences may contain modifiers that influence SPBC3E7.04c function.

  • Protein Expression Levels: Overexpression vs. endogenous expression can lead to different phenotypes.

Step 2: Statistical Analysis and Validation

  • Meta-analysis approach: Apply statistical methods to integrate results across studies:

    • Calculate effect sizes to standardize results across different measurement scales

    • Perform sensitivity analyses to identify condition-dependent effects

    • Use random-effects models to account for between-study heterogeneity

  • Validation experiments: Design experiments specifically to address contradictions:

Contradictory Finding TypeValidation ApproachControls to Include
Localization discrepanciesMulti-tag approach with live imagingFixed cells vs. live cells, different fixation methods
Phenotypic differencesComplementation with titrated expressionWild-type, empty vector, dose-response curve
Interaction partner conflictsOrthogonal interaction methods (Y2H, BiFC, FRET)Known interactors, non-specific binding controls
Functional role disagreementsConditional alleles (temperature-sensitive, auxin-inducible)Time-course analysis, partial vs. complete loss-of-function

Step 3: Biological Interpretation Framework

Consider these potential biological explanations for contradictory results:

  • Context-dependent function: SPBC3E7.04c may have different roles depending on cellular conditions or developmental stages.

  • Multifunctionality: The protein may have multiple distinct functions that are differentially revealed by various experimental approaches.

  • Compensatory mechanisms: Long-term genetic modifications may trigger compensatory pathways not present in acute functional studies.

  • Technical artifacts: Some contradictions may result from limitations in experimental techniques rather than true biological differences.

By systematically analyzing contradictions through this framework, researchers can often reconcile apparently conflicting results and develop a more nuanced understanding of SPBC3E7.04c function.

What statistical methods are most appropriate for analyzing protein interaction data involving SPBC3E7.04c?

For High-Throughput Interaction Screens:

  • False Discovery Rate (FDR) Control:

    • Apply Benjamini-Hochberg procedure to control for multiple testing

    • Set appropriate q-value thresholds (typically 0.05 or 0.01) based on experimental design

    • Compare results with more stringent Bonferroni correction to identify highest-confidence interactions

  • Enrichment Analysis:

    • Calculate fold enrichment over background for each potential interactor

    • Apply hypergeometric tests to identify significantly enriched functional categories

    • Use permutation tests to establish empirical p-values for interaction networks

For Quantitative Interaction Measurements:

Data TypeRecommended Statistical MethodAssumptionsAlternative Approaches
Co-IP with quantitative MSSAINT algorithm or CompPASSNormal distribution of spectral countsNon-parametric bootstrapping
Fluorescence-based interaction assaysLinear regression with residual analysisLinearity, homoscedasticitySpline fitting for non-linear relationships
Surface Plasmon ResonanceNon-linear regression for kinetic parameters1:1 binding modelGlobal fitting across multiple concentrations
Yeast two-hybridFisher's exact test for binary outcomesIndependence between samplesBayesian inference with informative priors

Validation and Quality Control:

  • Replicate Analysis:

    • Calculate coefficient of variation across technical replicates (<20% acceptable)

    • Use hierarchical clustering of biological replicates to assess reproducibility

    • Apply ANOVA to detect significant differences between experimental conditions

  • Correlation Analysis:

    • Calculate Spearman's rank correlation between different interaction detection methods

    • Use principal component analysis to identify major sources of variation in the dataset

    • Apply network comparison statistics to evaluate consistency across studies

Visualization and Interpretation:

  • Generate interaction networks with confidence-weighted edges based on statistical significance

  • Apply community detection algorithms to identify functional modules

  • Perform sensitivity analysis by varying statistical thresholds to assess result robustness

What are common experimental challenges when working with SPBC3E7.04c and how can they be addressed?

Researchers working with SPBC3E7.04c may encounter several experimental challenges that require systematic troubleshooting approaches:

Challenge 1: Protein Solubility and Stability Issues

The amino acid sequence of SPBC3E7.04c contains regions that may affect solubility . To address this:

  • Solution: Optimize buffer conditions by testing various pH values (6.5-8.0) and salt concentrations (100-500 mM NaCl).

  • Alternative approach: Express the protein with solubility-enhancing tags such as MBP or SUMO.

  • Stability enhancement: Add 50% glycerol to storage buffers as indicated in the product information .

  • Domain-based approach: Consider expressing individual domains rather than the full-length protein for structural studies.

Challenge 2: Low Expression Yields

  • Codon optimization: Adapt the coding sequence to the expression host's codon usage preferences.

  • Expression conditions: Test multiple temperatures (16°C, 25°C, 30°C) and induction conditions.

  • Host selection: Compare expression levels in E. coli, S. cerevisiae, and native S. pombe systems.

  • Validation: Confirm protein identity using mass spectrometry to ensure the correct protein is being produced.

Challenge 3: Functional Assay Development

Without established assays specific to SPBC3E7.04c, researchers must develop appropriate functional tests:

Potential FunctionAssay ApproachControlsTroubleshooting Steps
Regulatory roleReporter gene assaysConstitutive promoters, known regulatorsTitrate protein concentration, vary time points
Protein-protein interactionsPull-down assays, Y2HNon-specific binding controlsAdjust binding/washing conditions, use different tags
Enzymatic activitySubstrate conversion assaysHeat-inactivated enzymeTest various potential substrates, adjust cofactors
Cellular localizationFluorescent microscopyKnown compartment markersTest different fixation methods, use multiple tags

Challenge 4: Phenotypic Analysis Interpretation

  • Genetic redundancy: Create double/triple mutants with related genes to overcome redundancy.

  • Conditional alleles: Develop temperature-sensitive or chemical-sensitive alleles for studying essential functions.

  • Quantitative phenotyping: Implement high-content imaging or flow cytometry for subtle phenotypes.

  • Multi-condition testing: Assess phenotypes under various stresses (oxidative, heat, nutrient limitation).

Challenge 5: Reproducibility Issues

  • Standardized protocols: Develop detailed SOPs for key experiments.

  • Strain verification: Regularly sequence-verify strains to detect spontaneous suppressors.

  • Environmental control: Document and control temperature, humidity, and batch effects.

  • Data management: Implement comprehensive data tracking to identify sources of variation.

By anticipating these challenges and implementing appropriate mitigation strategies, researchers can significantly improve experimental outcomes when working with SPBC3E7.04c.

How can I design experiments to determine if SPBC3E7.04c has post-translational modifications in vivo?

Designing experiments to identify and characterize post-translational modifications (PTMs) of SPBC3E7.04c requires a multi-faceted approach combining both in vivo and in vitro techniques:

Mass Spectrometry-Based Approaches:

  • Sample Preparation Strategy:

    • Express tagged SPBC3E7.04c in S. pombe under native promoter

    • Perform immunoprecipitation under conditions that preserve PTMs (phosphatase inhibitors, deacetylase inhibitors)

    • Process samples with PTM-preserving protocols (avoid excessive heat, extreme pH)

  • MS Analysis Framework:

    • Perform bottom-up proteomics with multiple proteases (trypsin, chymotrypsin) to increase sequence coverage

    • Implement neutral loss scanning for phosphorylation sites

    • Use electron transfer dissociation (ETD) for preserving labile modifications

    • Apply parallel reaction monitoring (PRM) for targeted quantification of modified peptides

Complementary Biochemical Approaches:

PTM TypeDetection MethodControlsQuantification Approach
PhosphorylationPhos-tag gels, phospho-specific antibodiesPhosphatase treatment, phospho-mimetic mutationsRatios of modified to unmodified peptides
UbiquitinationAnti-ubiquitin western blots, TUBEs pulldownProteasome inhibitors, K→R mutations of target sitesUbiquitin remnant profiling
GlycosylationLectin blots, glycosidase mobility shiftsGlycosylation inhibitors, site-directed mutagenesisGlycopeptide enrichment and MS
AcetylationAnti-acetyl-lysine antibodiesHDAC inhibitors, K→R mutationsSILAC with acetylation site enrichment

Cellular Context and Dynamics:

  • Condition-dependent modifications:

    • Compare PTM profiles across different growth phases

    • Analyze changes in PTM patterns under stress conditions

    • Examine cell cycle-dependent modifications

  • Site-specific functional analysis:

    • Generate non-modifiable mutants (S→A, K→R) at predicted sites

    • Create phosphomimetic variants (S→D/E) to test functional consequences

    • Employ auxin-inducible degron tags to study temporal dynamics

Bioinformatic Prediction and Validation:

  • Apply PTM prediction algorithms (NetPhos, UbPred) to identify potential modification sites

  • Perform evolutionary conservation analysis of predicted sites across species

  • Integrate proteomic data with transcriptomic and phenotypic data to establish functional relevance

Validation in physiological context:

  • Use CRISPR/Cas9 to introduce tagged wild-type and non-modifiable versions at the endogenous locus

  • Perform phenotypic analysis under various conditions to determine functional consequences

  • Employ proximity labeling techniques to identify interactors specific to modified forms

This comprehensive experimental design enables researchers to identify, characterize, and determine the functional significance of PTMs on SPBC3E7.04c in its native cellular context.

How can findings from SPBC3E7.04c research be applied to understand human disease mechanisms?

Research on SPBC3E7.04c in S. pombe can provide valuable insights into human disease mechanisms due to the significant conservation of cellular processes between fission yeast and humans . Translating these findings requires a strategic approach:

Homology and Functional Conservation Analysis:

  • Identifying human homologs:

    • Perform comprehensive sequence and structural homology searches to identify human counterparts

    • Analyze conservation of key domains and functional residues

    • Determine if human homologs have been implicated in disease pathways

  • Functional complementation studies:

    • Express human homologs in S. pombe SPBC3E7.04c mutants to test functional rescue

    • Create chimeric proteins to identify critical functional domains

    • Introduce disease-associated mutations from human homologs into S. pombe proteins

Disease Relevance Framework:

S. pombe resembles human cells in several key aspects relevant to disease mechanisms:

  • Mitochondrial processes: Given S. pombe's similarity to humans in mitochondrial inheritance and function , SPBC3E7.04c research may inform understanding of mitochondrial diseases if the protein is involved in these processes.

  • Metabolic regulation: If SPBC3E7.04c participates in sugar metabolism pathways conserved between S. pombe and humans , findings might be relevant to metabolic disorders.

  • Gene expression mechanisms: The conservation of gene expression machinery between fission yeast and humans suggests potential applications to diseases involving transcriptional or translational dysregulation.

Translational Research Approaches:

Disease CategoryS. pombe Model ApproachHuman Disease RelevanceValidation Strategy
Mitochondrial disordersStudy SPBC3E7.04c effects on mtDNA maintenancePotential insights into mtDNA depletion syndromesCompare phenotypes with patient-derived cells
Metabolic diseasesAnalyze metabolic flux changes in mutantsMay inform understanding of metabolic pathway disordersTest identified metabolites as biomarkers in patients
Cancer biologyExamine effects on cell cycle regulationPotential oncogenic or tumor suppressor roles of human homologsScreen cancer genomics databases for mutations in homologs
Neurodegenerative diseasesStudy protein aggregation and quality controlInsights into proteostasis mechanismsTest modifiers in mammalian neuronal models

Implementation Strategy:

  • Establish collaborative networks between yeast researchers and clinical investigators

  • Develop high-throughput screening platforms in S. pombe to test disease-relevant compounds

  • Create disease-specific yeast models expressing human variants

  • Apply systems biology approaches to integrate yeast findings with human disease data

By systematically translating findings from SPBC3E7.04c research in S. pombe to human biology, researchers can leverage this model organism's experimental advantages to accelerate discoveries relevant to human disease mechanisms and potential therapeutic approaches.

What comparative proteomic approaches can be used to study SPBC3E7.04c and its potential human homologs?

Comparative proteomic approaches offer powerful tools for understanding the relationship between SPBC3E7.04c and potential human homologs, enabling translational insights:

Sequence-Based Comparative Proteomics:

  • Profile-profile alignments:

    • Generate position-specific scoring matrices from multiple sequence alignments

    • Apply HHpred or HMMER to detect remote homology beyond standard BLAST detection

    • Quantify similarity using statistical measures (e-values, alignment scores)

  • Domain architecture analysis:

    • Map conserved domains using InterPro and Pfam databases

    • Analyze domain organization conservation across species

    • Identify lineage-specific domain acquisitions or losses

Structural Proteomics Comparison:

  • Structural modeling and comparison:

    • Generate homology models of SPBC3E7.04c and human homologs

    • Perform structural alignments to identify conserved binding pockets and interaction surfaces

    • Apply molecular dynamics simulations to compare dynamic properties

  • Experimental structure determination:

    • Crystallize recombinant proteins from both species

    • Analyze by X-ray crystallography or cryo-EM

    • Compare binding sites and conformational states

Functional Proteomics Comparison:

ApproachMethodologyExpected OutcomesAnalysis Techniques
Interactome MappingAP-MS or BioID in both S. pombe and human cellsIdentification of conserved interaction networksNetwork alignment algorithms, GO enrichment
PTM ProfilingPhosphoproteomics, acetylomics in both systemsComparison of regulatory modification sitesPTM site conservation analysis, regulatory motif identification
Protein LocalizationFluorescent tagging in both systemsSubcellular distribution patternsCo-localization analysis, compartment enrichment statistics
Protein TurnoverSILAC pulse-chase in both systemsDegradation kinetics and stabilityHalf-life comparison, degradation pathway conservation

Cross-species Validation Approaches:

  • Heterologous expression:

    • Express human homologs in S. pombe SPBC3E7.04c deletion strains

    • Test complementation of phenotypes

    • Analyze effects of disease-associated mutations

  • CRISPR-based humanization:

    • Replace domains in SPBC3E7.04c with human counterparts

    • Engineer critical residues to match human sequence

    • Assess functional consequences of humanization

Data Integration Framework:

  • Create ortholog mapping tables with confidence scores

  • Build phylogenetic profiles to identify co-evolving proteins

  • Develop functional correspondence maps between yeast and human pathways

  • Apply machine learning to predict function conservation

Quantitative Comparative Analysis:

  • Protein expression correlation:

    • Compare abundance changes across conditions in both species

    • Analyze co-expression patterns with known interactors

    • Identify conserved regulatory relationships

  • Modification stoichiometry:

    • Quantify PTM site occupancy across species

    • Compare modification dynamics in response to stimuli

    • Identify conserved regulatory mechanisms

By implementing these comparative proteomic approaches, researchers can build robust bridges between SPBC3E7.04c studies in S. pombe and potential human homologs, facilitating translational insights and potential therapeutic applications.

What are the key considerations for developing a comprehensive research program focused on SPBC3E7.04c?

Developing a comprehensive research program centered on SPBC3E7.04c requires strategic planning that integrates multiple experimental approaches and builds a cohesive understanding of this protein. Key considerations include:

Foundational Research Components:

  • Genetic and phenotypic characterization:

    • Generate complete deletion and conditional mutants

    • Perform genome-wide synthetic genetic array analysis

    • Conduct high-throughput phenotypic profiling under diverse conditions

  • Molecular and cellular function determination:

    • Map protein localization dynamics throughout the cell cycle

    • Establish the complete interactome using complementary approaches

    • Determine the effects of mutation on cellular processes

  • Structural biology integration:

    • Resolve three-dimensional structure through crystallography or cryo-EM

    • Identify functional domains through structure-guided mutagenesis

    • Model protein dynamics through molecular dynamics simulations

Advanced Research Directions:

The value of S. pombe as a model organism stems from its similarities to human cells in mitochondrial function, metabolism, and gene expression machinery . A comprehensive program should leverage these advantages by:

  • Exploiting S. pombe's experimental accessibility:

    • Apply the extensive genetic tools available for S. pombe

    • Utilize established database resources for comparative analysis

    • Implement high-throughput screening approaches to identify genetic and chemical modifiers

  • Building translational connections:

    • Identify and characterize human homologs

    • Develop humanized yeast strains expressing counterpart proteins

    • Collaborate with clinical researchers to explore disease relevance

Resource Development and Data Integration:

  • Generate community resources:

    • Create an antibody repository for consistent detection

    • Develop standardized assays for functional assessment

    • Establish a mutant collection covering key functional domains

  • Implement integrated data analysis:

    • Apply systems biology approaches to integrate multi-omics data

    • Develop computational models of protein function

    • Create visualization tools for complex datasets

By balancing these considerations, researchers can develop a comprehensive program that not only elucidates the fundamental biology of SPBC3E7.04c but also positions this knowledge within the broader context of conserved cellular processes relevant to human health and disease.

How can researchers contribute SPBC3E7.04c findings to community resources and databases?

Effective contribution of SPBC3E7.04c research findings to community resources ensures data accessibility, promotes collaboration, and accelerates scientific progress. Researchers should consider these structured approaches:

Database Submission Guidelines:

  • Sequence and structure data:

    • Submit refined protein sequences to UniProt (accession G2TRT0)

    • Deposit structural data in the Protein Data Bank (PDB)

    • Register new mutations or variants in S. pombe specific databases

  • Functional genomics data:

    • Submit microarray or RNA-seq data to GEO or ArrayExpress

    • Deposit proteomics datasets in PRIDE or MassIVE

    • Register phenotypic data in PomBase

Standardized Reporting Frameworks:

Data TypePrimary RepositoryRequired MetadataFormatting Guidelines
Protein-protein interactionsBioGRID, IntActExperimental method, confidence scoresPSI-MI XML format
Localization dataPomBase, UniProtCell conditions, microscopy parametersControlled vocabulary terms
Functional annotationsGene OntologyEvidence codes, reference citationsGAF 2.0 format
Genetic interactionsBioGRID, PomBaseInteraction type, phenotypic effectStandard genetic nomenclature

Community Engagement Strategies:

  • Resource development:

    • Contribute validated reagents to repositories like Addgene

    • Share detailed protocols on platforms like protocols.io

    • Develop and share computational tools and scripts via GitHub

  • Knowledge synthesis:

    • Update Wikipedia entries with new findings

    • Contribute to review articles and book chapters

    • Participate in community annotation projects

Data Integration Best Practices:

  • Use consistent identifiers across submissions (e.g., systematic name SPBC3E7.04c)

  • Provide cross-references between related datasets

  • Include detailed metadata describing experimental conditions

  • Follow FAIR principles (Findable, Accessible, Interoperable, Reusable)

Quality Control Considerations:

  • Validate findings through independent methods before submission

  • Include appropriate statistical analyses and significance measures

  • Clearly document limitations and potential sources of error

  • Provide raw data alongside processed results when possible

Collaborative Framework Development:

  • Engage with database curators to ensure proper data representation

  • Participate in community workshops to establish data standards

  • Contribute to ontology development for consistent terminology

  • Support community-driven annotation initiatives

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.