Recombinant Schizosaccharomyces pombe Syntaxin-like protein psy1 (psy1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
psy1; sso1; SPCC825.03c; Syntaxin-like protein psy1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
psy1
Target Protein Sequence
MNKANDYTLGVEMIPLSMGEFFEEIDHIRDAIRQIEDNVGRIEMLHQQSLQEIDEANIAA TTRHLEGYTSDTRRLQTSVQLAIRSLESQNMQLPPDNDTATRKTQTEAVKKKFMDQIRHF LQIEKTYRAQYEQRMRRQLEIANPRATEDDFQTAINEENGGQVFAQALLRSNRSGEARTA LREVQERHADIKRIERTIAELAQLFQDMATMVQEQEPMVDKIVTDAVNVRTNMGEGTQHM DRAIKSARAARKKKWICFGICVVIICVIVAVLCGVLIPVLGNRH
Uniprot No.

Target Background

Gene References Into Functions
  1. In Schizosaccharomyces pombe, meiotic endocytosis undergoes changes that facilitate Psy1 internalization and subsequent sporulation. [PMID: 21832151](https://www.ncbi.nlm.nih.gov/pubmed/21832151)
  2. Slk1p and Sid2p contribute to forespore membrane assembly by recruiting secretory apparatus components, such as Psy1p, to promote membrane expansion. [PMID: 18562696](https://www.ncbi.nlm.nih.gov/pubmed/18562696)
Database Links
Protein Families
Syntaxin family
Subcellular Location
Cell membrane; Single-pass type IV membrane protein. Prospore membrane. Note=During vegetative growth located at the plasma membrane. As meiosis II is initiated located at the forespore membrane.

Q&A

What is Psy1 and what is its primary function in Schizosaccharomyces pombe?

Psy1 is a syntaxin 1 homolog in the fission yeast Schizosaccharomyces pombe that functions as a critical component of the t-soluble N-ethylmaleimide-sensitive factor attachment protein receptor (t-SNARE) complex. This complex plays an essential role in docking membrane vesicles at target membranes, a process highly conserved among eukaryotes. Initially, the psy1+ gene was isolated as a multicopy suppressor of the sporulation-deficient mutant spo3, indicating its involvement in the sporulation process. Further research has established that Psy1 is indispensable for proper formation of the forespore membrane (FSM) during sporulation in S. pombe, coordinating this process with other SNARE proteins including Syb1 and Sec9 .

The protein functions at a critical juncture of membrane development during meiosis II, where it facilitates the expansion of the forespore membrane after its initial assembly near the spindle pole bodies. Without functional Psy1, this expansion is severely impaired, resulting in sporulation defects characterized by anucleated prespores .

How was the psy1-S1 mutant created and what is its phenotype?

The psy1-S1 mutant was generated through random PCR mutagenesis, resulting in a single nucleotide change (T to C) that replaced leucine 139 with proline in the Psy1 protein . This mutation produces two distinct phenotypes:

  • Temperature sensitivity in vegetative growth

  • Severe sporulation defects

The dual phenotype of the psy1-S1 mutant suggests that Psy1 has essential functions in both vegetative growth and sexual reproduction in S. pombe, likely through its role in membrane trafficking events.

What is the relationship between Psy1 and other SNARE proteins?

Psy1 functions in coordination with other SNARE proteins, particularly Syb1 and Sec9, to facilitate membrane fusion events during forespore membrane formation. This relationship has been demonstrated through suppression experiments, where overproduction of these cognate SNARE proteins was found to suppress both the temperature sensitivity and sporulation defects of the psy1-S1 mutant .

The functional relationship between these proteins is consistent with our understanding of SNARE complexes in other organisms, where syntaxins (like Psy1) typically work together with synaptobrevin/VAMP family proteins (like Syb1) and SNAP-25 homologs (like Sec9) to form the core SNARE complex that drives membrane fusion .

The phenotypic similarities between psy1-S1 and sec9-10 mutants further support their coordinated action, as both exhibit defects in forespore membrane development .

What are the recommended methods for expressing recombinant Psy1 protein?

Purification Strategy:
For functional studies of recombinant Psy1, researchers should consider the following protocol:

  • Clone the psy1+ gene excluding the transmembrane domain (typically C-terminal) to improve solubility

  • Add an affinity tag (His6 or GST) to the N-terminus for purification

  • Express at low temperatures (16-20°C) to improve folding

  • Use mild detergents (DDM or CHAPS) for membrane protein extraction

  • Implement a two-step purification using affinity chromatography followed by size exclusion

Expression Conditions Table:

Expression SystemVectorInductionTemperatureYieldAdvantages
E. coli BL21(DE3)pET-28a0.1-0.5 mM IPTG18°C, 16hModerateCost-effective, rapid
P. pastorispPICZMethanol28°C, 48-72hHighProper folding, post-translational modifications
S. pombepREPThiamine removal30°C, 24hLow-moderateNative environment, authentic function

Note that membrane proteins often require optimization of solubilization conditions for functional activity.

How can researchers generate and characterize new Psy1 mutants?

Mutant Generation Methods:

  • Site-Directed Mutagenesis: To target specific domains (such as the 130-238 amino acid region that interacts with other proteins), using overlap extension PCR or commercial kits.

  • Random Mutagenesis: As demonstrated with the psy1-S1 mutant, error-prone PCR can generate random mutations for phenotypic screening . For this approach:

    • Use manganese or unbalanced dNTPs to increase error rates

    • Adjust PCR cycles to control mutation frequency

    • Integrate into a shuttle vector for expression in S. pombe

  • CRISPR-Cas9 Genome Editing: Particularly useful for creating mutations directly in the genomic locus without leaving marker sequences, following NIH guidelines for recombinant DNA research .

Characterization Pipeline:

  • Phenotypic Analysis:

    • Temperature sensitivity testing (growth at 25°C vs. 36°C)

    • Sporulation efficiency quantification

    • FSM formation analysis via fluorescence microscopy

  • Protein Interaction Analysis:

    • Yeast two-hybrid assays to test interactions with Syb1 and Sec9

    • Co-immunoprecipitation to verify protein-protein interactions in vivo

    • Pull-down assays with recombinant proteins for direct interaction studies

  • Localization Studies:

    • GFP-tagging to monitor Psy1 localization during sporulation

    • Immunofluorescence with anti-Psy1 antibodies

What techniques are most effective for studying Psy1's role in membrane fusion?

In Vitro Fusion Assays:
Reconstituted proteoliposome fusion assays can directly test Psy1's function in membrane fusion. This approach involves:

  • Purifying recombinant Psy1, Syb1, and Sec9 proteins

  • Reconstituting proteins into separate liposome populations

  • Labeling donor liposomes with fluorescent lipids (NBD-PE and Rhodamine-PE)

  • Monitoring fusion through fluorescence dequenching

  • Validating specificity through inhibition with soluble domains of SNARE proteins

Live Cell Imaging Approaches:

  • Time-lapse microscopy of fluorescently tagged Psy1 during sporulation to track dynamics

  • FRAP (Fluorescence Recovery After Photobleaching) to measure Psy1 mobility in membranes

  • Super-resolution microscopy (PALM/STORM) to detect SNARE complex formation at nanoscale

Genetic Interaction Analysis:
Systematic genetic interaction studies can map Psy1's functional network:

  • Create double mutants between psy1-S1 and other sporulation/membrane trafficking mutants

  • Perform epistasis analysis to determine pathway relationships

  • Use high-content screening to identify suppressors and enhancers of psy1-S1 phenotypes

How does homologous recombination technology apply to Psy1 research?

CRISPR-Cas9 technology can facilitate precise genetic modifications to study Psy1 function. This approach allows targeted recombination between homologous chromosomes upon somatic induction of DNA double-strand breaks (DSBs) .

Implementation Strategy:

  • Design guide RNAs targeting specific regions of the psy1+ gene

  • Create donor templates containing desired mutations or tags

  • Deliver components via transformation into S. pombe cells

  • Screen for successful recombinants through phenotypic analysis or molecular detection

Applications in Psy1 Research:

  • Domain swapping: Replace domains of Psy1 with homologous regions from other syntaxins

  • Fluorescent tagging: Insert fluorescent protein tags without disrupting function

  • Conditional alleles: Create temperature-sensitive or auxin-inducible degron versions of Psy1

This approach must follow NIH guidelines for research involving recombinant or synthetic nucleic acid molecules, ensuring proper biosafety practices and containment principles .

What are common challenges in purifying functional recombinant Psy1 protein?

Recombinant Psy1 purification presents several challenges due to its membrane protein nature:

  • Poor solubility: The hydrophobic transmembrane domain often causes aggregation

  • Misfolding: E. coli expression systems may not provide proper chaperones

  • Low yield: Membrane protein overexpression can be toxic to host cells

  • Loss of function: Detergent solubilization may disrupt native conformation

Optimization Strategies Table:

ChallengeRecommended SolutionAlternative Approach
AggregationExpress truncated version without transmembrane domainUse fusion partners (MBP, SUMO) to enhance solubility
MisfoldingLower expression temperature (16-18°C)Switch to eukaryotic expression system
Low yieldUse specialized E. coli strains (C41/C43)Screen different promoter strengths
Detergent sensitivityTest detergent panel (DDM, OG, LDAO)Use amphipols or nanodiscs for stabilization
DegradationAdd protease inhibitors during purificationInclude stabilizing ligands in buffers

When purifying Psy1 for functional studies, researchers should validate protein quality through dynamic light scattering, circular dichroism, and binding assays with known interactors like Syb1 and Sec9.

How can researchers effectively visualize Psy1 localization during sporulation?

Visualizing Psy1 during sporulation requires techniques optimized for the unique cellular context of meiotic S. pombe cells:

Recommended Approach:

  • Fluorescent Protein Tagging:

    • GFP-tag Psy1 at the N-terminus to avoid interfering with the C-terminal transmembrane domain

    • Validate that the fusion protein complements psy1Δ phenotypes

    • Express under native promoter to maintain physiological levels

  • Co-localization Analysis:

    • Simultaneously visualize Psy1 with markers for:

      • Spindle pole bodies (Sid4-RFP)

      • Plasma membrane (FM4-64)

      • Nuclear envelope (Cut11-RFP)

    • Use confocal microscopy with Z-stacking to capture 3D distribution

  • Temporal Analysis:

    • Synchronize cells for meiotic entry using nitrogen starvation

    • Collect samples at regular intervals (every 30 minutes)

    • Identify meiotic stages through DAPI staining of nuclei

Image Analysis Parameters:

  • Use deconvolution to improve signal-to-noise ratio

  • Quantify Psy1 distribution using line scan analysis across developing FSM

  • Measure colocalization with other markers using Pearson's correlation coefficient

Studies show that in wild-type cells, Psy1 initially localizes near spindle pole bodies during meiosis II and then expands with the developing forespore membrane. In psy1-S1 mutants, initial localization occurs, but the subsequent expansion is severely impaired .

What are the implications of Psy1 research for understanding SNARE function in higher eukaryotes?

Research on Psy1 in S. pombe provides valuable insights into conserved mechanisms of membrane fusion across eukaryotes. The core principles of SNARE-mediated membrane fusion appear to be maintained from yeasts to humans, making Psy1 an excellent model for studying fundamental aspects of this process.

Current findings suggest several translational implications:

  • Insights into specialized membrane fusion events during developmental processes

  • Understanding of how SNARE proteins coordinate with other cellular machinery

  • Potential targets for antifungal development based on unique features of fungal SNAREs

  • Models for studying diseases related to membrane trafficking defects

Future research should explore the structural determinants of Psy1 specificity, the regulatory mechanisms controlling its activity during sporulation, and the broader network of interacting partners beyond the core SNARE complex.

The combination of genetic, biochemical, and imaging approaches in this model system will continue to yield valuable insights into membrane fusion mechanisms with broad relevance across eukaryotic biology.

How do different recombinant Psy1 expression systems compare for structural studies?

For structural studies of Psy1, the expression system choice is critical for obtaining sufficient quantities of properly folded protein:

Comparative Analysis of Expression Systems for Structural Studies:

SystemYield (mg/L)Suitable forLimitationsSpecial Considerations
E. coli0.5-2X-ray crystallography, NMR (partial domains)Improper folding of full-length proteinFusion with crystallization chaperones (T4 lysozyme) may improve success
Insect cells1-5Cryo-EM, X-ray crystallographyHigher cost, longer timelineBaculovirus expression system provides better folding environment
Yeast (P. pastoris)2-8Native-like studies, cryo-EMGlycosylation heterogeneityMethylotrophic induction allows controlled expression
Cell-free0.1-0.5NMR studies with labeled amino acidsLow yield, high costDirect incorporation of unnatural amino acids possible

For recent structural studies of syntaxin family proteins, cryo-electron microscopy has emerged as the preferred technique, especially for capturing SNARE complexes in different conformational states. This approach typically requires:

  • Expression of full-length or minimally truncated Psy1

  • Complex formation with partner SNARE proteins (Syb1, Sec9)

  • Stabilization in detergent micelles or nanodiscs

  • Purification to homogeneity via affinity and size-exclusion chromatography

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.