Recombinant Schizosaccharomyces pombe Translocation protein sec62 (sec62)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sec62; SPAC17G6.09; Translocation protein sec62
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
Target Protein Sequence
MDSSNVPVLKDEDKCKFSMRFTNFLKSRPELKTKPAILNGKRVYYFRVKRVLRFLTSEAY TPKKYKGFPEISSREEAIEVLKLLIMNSMLVRVDKLPPKQRKQKLVELQINRNQDFQDDM HYVWLYEPLPKRVMALAVLFALVVLALVLFPLWPMFMRKGAWYLSMGGLGVIGLFFVLVI LRFFLFCITAVIVRPGIWLFPNLLADVGFCDSFKPLWSWHNSKSEVKKTRKSKKLSKKAT SPAASATPEKSSTSTTSLKNLRHRNPTVEEVSE
Uniprot No.

Target Background

Function

Recombinant Schizosaccharomyces pombe Translocation protein sec62 (sec62) acts as a component of the Sec62/63 complex. This complex is involved in SRP-independent post-translational translocation across the endoplasmic reticulum (ER). It functions in conjunction with the Sec61 complex and Bip1 within a channel-forming translocon complex. The signal sequence appears to initially bind to both Sec61 and Sec62 simultaneously. Sec62 and Sec63 are essential for interactions between Sec61 and translocating polypeptides. Sec62 may influence Sec61-polypeptide interactions by enhancing the affinity of targeting pathways for Sec61 and/or by modifying Sec61 to facilitate more efficient polypeptide interaction. A cycle of Sec62/63 complex assembly and disassembly from Sec61 may regulate translocon activity.

Database Links
Protein Families
SEC62 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Sec62 and what is its significance in Schizosaccharomyces pombe?

Sec62 is a translocation protein located in the endoplasmic reticulum (ER) membrane that plays a critical role in protein translocation across the ER membrane. In S. pombe, as in other eukaryotes, this protein is essential for the secretory pathway. Sec62 functions primarily in the posttranslational translocation of proteins, particularly those with short signal sequences. The protein has also been implicated in maintaining intracellular Ca2+ homeostasis through regulation of Ca2+ efflux from the ER lumen .

Comparative studies suggest that the machinery for gene expression, including proteins involved in translocation like Sec62, is structurally and functionally conserved between fission yeast and humans, making S. pombe an excellent model for studying these processes .

Why is S. pombe preferred as a model organism for studying protein translocation?

S. pombe offers several advantages as a model organism for studying protein translocation and Sec62 function:

  • S. pombe demonstrates remarkable similarity to human cells in cellular processes, making findings more translatable to human biology

  • Molecular research on S. pombe is supported by a considerable number of experimental techniques and database resources

  • S. pombe shows higher conservation in chromosome structure and function genes compared to Saccharomyces cerevisiae

  • The organism is genetically tractable, allowing for relatively straightforward genetic manipulations

  • Despite diverging from S. cerevisiae approximately a billion years ago, S. pombe maintains significant gene similarity to humans, particularly in pathways relevant to disease

These characteristics make S. pombe particularly valuable for studying evolutionarily conserved proteins like Sec62 and their functions in the context of protein trafficking and ER homeostasis.

What are the typical methods for recombinant expression of Sec62 in S. pombe?

The expression of recombinant Sec62 in S. pombe typically involves:

  • Selection of appropriate expression vectors containing S. pombe-compatible promoters

  • Incorporation of epitope tags (e.g., h-tag or FLAG-tag) for detection and purification purposes

  • Transformation using standard protocols such as lithium acetate-based methods or electroporation

  • Selection of transformants using appropriate markers

  • Verification of expression through Western blotting techniques

When expressing tagged versions of Sec62, it's crucial to verify that the tag doesn't interfere with protein function, especially given Sec62's membrane localization and role in protein translocation.

How can CRISPR-Cas9 be implemented to study Sec62 function in S. pombe?

CRISPR-Cas9 technology can be effectively adapted for S. pombe to generate SEC62 knockout strains:

  • Design guide RNAs targeting the SEC62 gene sequence

  • Clone gRNAs into a Cas9-expressing vector optimized for S. pombe

  • Transform cells and select potential knockout clones

  • Validate CRISPR events using next-generation sequencing (NGS)

  • Analyze sequencing data using platforms like CRISPResso2 to identify indels and mutations

  • Confirm knockout at the protein level via Western blot analysis

In CRISPR-based studies of SEC62, researchers have observed multiple alleles generated after Cas9 activity. For instance, in one system, five different alleles were identified, with the most common being a cytosine insertion before the PAM sequence (36% of reads) . Proper validation requires both genomic analysis and protein-level confirmation, with successful knockouts showing nearly undetectable protein levels (e.g., 0.04 ± 0.03 relative to wild-type) .

What techniques are available for investigating Sec62-mediated protein translocation in vivo?

Several approaches can be employed to study Sec62's role in protein translocation:

  • Co-immunoprecipitation assays: These can detect translocation intermediates comprising the substrate protein and Sec62. This approach has successfully identified Sec62-substrate complexes by treating cells with cycloheximide to slow nascent chain elongation, then immunoprecipitating with epitope-specific antibodies .

  • Reporter protein systems: Short reporter proteins tagged with detectable epitopes can be used to monitor Sec62-dependent translocation. For example, Rh-100 reporter proteins have been shown to co-immunoprecipitate with Sec62, whereas larger proteins like preprolactin do not form detectable complexes with Sec62 .

  • Pulse-labeling experiments: These allow for temporal analysis of protein translocation, especially when combined with specific inhibitors. Techniques involving metabolic labeling with radioactive amino acids can track newly synthesized proteins through the secretory pathway .

  • In vitro translocation assays: Cell-free systems using isolated membranes can assess the direct impact of Sec62 on protein translocation efficiency.

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationDetection of transient Sec62-substrate complexesCaptures physiological interactionsLimited to stable interactions; requires optimization of detergent conditions
Reporter protein systemsMonitoring translocation efficiencyQuantifiable; allows mutation analysisArtificial constructs may not reflect natural substrates
Pulse-labelingKinetic analysis of translocationProvides temporal informationTechnical complexity; requires radioactive materials
In vitro assaysDirect assessment of translocationControlled environmentMay not reflect in vivo complexity

How does functional inhibition of Sec62 affect cellular physiology?

Functional inhibition of Sec62 has significant cellular consequences:

  • Calcium homeostasis disruption: Inhibition of Sec62 stimulates Ca2+ efflux from the ER lumen, increasing cellular stress levels

  • Reduced proliferation: SEC62 knockout cells show significantly reduced proliferation rates compared to wild-type cells (p = 0.0095 for one clone; p = 3.34e−4 for another)

  • Decreased migration: Loss of SEC62 results in markedly reduced migratory potential

  • Protein translocation defects: Particularly affects translocation of proteins with short or weak signal sequences

These effects highlight Sec62's multifunctional role in both protein translocation and maintaining cellular homeostasis. The impact on proliferation and migration also explains why SEC62 amplification is associated with various cancer types, including head and neck squamous cell carcinomas .

What are effective methods for detecting Sec62-substrate interactions?

Detection of Sec62-substrate interactions requires careful experimental design:

  • Optimized immunoprecipitation protocols:

    • Use mild detergents (e.g., 0.25% Triton X-100) to preserve membrane protein interactions

    • Include stabilizing agents like glycerol (10%) and sodium molybdate (20 mM)

    • Incorporate protease inhibitors to prevent degradation during sample preparation

  • Slowing protein synthesis:

    • Treatment with cycloheximide (3 μg/ml for 1 hour) delays nascent chain elongation approximately fourfold, increasing the likelihood of capturing transient translocation intermediates

  • Controls:

    • Include antibody specificity controls (e.g., using anti-FLAG antibodies in cells not expressing FLAG-tagged proteins)

    • Compare known Sec62-dependent and Sec62-independent substrates (e.g., short proteins versus larger secretory proteins like preprolactin)

For successful detection, it's crucial to optimize lysis conditions (buffer composition: 20 mM Tris HCl, 10% glycerol, 20 mM sodium molybdate, 0.1 mM dithiothreitol, 0.25% Triton X-100, with protease inhibitors) and sample processing (including sonication three times for 30 seconds) .

What are common challenges in SEC62 knockout validation and how can they be addressed?

Creating and validating SEC62 knockouts presents several challenges:

  • Multiple alleles after CRISPR-Cas9: CRISPR-Cas9 editing frequently generates multiple alleles, requiring thorough sequencing and analysis. For example, in one study, five different alleles were identified after Cas9 activity .

  • Verification at multiple levels:

    • Genomic verification: Next-generation sequencing and analysis with specialized tools like CRISPResso2

    • Protein verification: Western blot analysis with appropriate controls, setting wild-type levels as reference (e.g., clone1: 0.04 ± 0.03; clone2: 0.03 ± 0.02 relative to wild-type)

  • Functional validation:

    • Proliferation assays using systems like xCELLigence to monitor growth kinetics over time

    • Migration assays such as the FluoroBlok system to assess cellular motility

    • Translocation efficiency measurements for known Sec62-dependent substrates

Robust validation requires combining these approaches to ensure complete loss of both the gene product and its associated functions.

How can S. pombe Sec62 studies inform cancer research?

Studies on Sec62 in S. pombe can provide valuable insights for cancer research:

  • Amplification mechanisms: Understanding how SEC62 amplification (common in the chromosomal region 3q26) affects cellular functions in the simplified S. pombe system can illuminate its role as a potential driver oncogene .

  • Therapeutic targeting: Since the SEC62 protein is intracellularly located and poorly accessible to therapeutic antibodies, functional inhibition studies in S. pombe can identify viable approaches to counteract SEC62 activity .

  • Mechanistic studies: Investigating how Sec62's dual roles in protein translocation and calcium homeostasis contribute to cancer cell survival, proliferation, and migration .

  • Drug development: S. pombe systems can be used to screen for compounds that antagonize Sec62 function, potentially identifying candidates like trifluoperazine and thapsigargin that show promise in counteracting SEC62-driven cancer cell properties .

The amplification of SEC62 observed in various cancer types, particularly head and neck squamous cell carcinomas, and its association with poor outcomes and increased metastatic burden, underscore the clinical relevance of basic research on this protein .

What is the relationship between Sec62's functions in protein translocation and calcium homeostasis?

The dual functionality of Sec62 in protein translocation and calcium homeostasis represents an intriguing area of research:

  • Functional connection: Sec62 appears to regulate Ca2+ efflux from the ER lumen, with inhibition of Sec62 increasing cellular stress levels through calcium release .

  • Therapeutic implications: This dual functionality makes Sec62 an attractive therapeutic target, as disrupting its calcium regulatory function can potentially limit tumor growth and metastasis formation .

  • Mechanistic studies: Research in model systems like S. pombe can help elucidate how these seemingly distinct functions—protein translocation and calcium regulation—are coordinated within a single protein.

  • Stress response: The connection between Sec62, calcium homeostasis, and cellular stress responses may explain why SEC62 amplification confers survival advantages to cancer cells in stressful tumor microenvironments.

Understanding this relationship could lead to novel therapeutic approaches that specifically target one function without affecting the other, potentially reducing side effects.

How can established S. pombe assays be adapted to study Sec62 function?

S. pombe offers several established assay systems that can be adapted for Sec62 research:

  • Mitotic recombination assays: The well-developed in vivo genetic assays for studying mitotic recombination in S. pombe could be modified to investigate Sec62's potential involvement in DNA damage response pathways.

  • Chromosome-based assays: The minichromosome Ch 16 system, which has been extensively used in S. pombe recombination studies , could be adapted to incorporate SEC62 variants to study their impact on genomic stability.

  • CRISPR-based functional screens: The validated CRISPR-Cas9 approach for generating SEC62 knockouts could be expanded into genome-wide screens to identify genetic interactors of SEC62.

  • Protein-protein interaction networks: S. pombe's genetic tractability makes it ideal for mapping Sec62's interaction network through systematic studies combining genetic and biochemical approaches.

The advantage of these approaches lies in S. pombe's powerful genetics, which allows for relatively straightforward creation and analysis of mutants , combined with its relevance to human biology due to the high conservation of many cellular processes .

What emerging technologies hold promise for advancing Sec62 research in S. pombe?

Several cutting-edge technologies could significantly advance Sec62 research in S. pombe:

  • Cryo-electron microscopy: Applied to purified S. pombe translocons containing Sec62, this could reveal structural insights into how Sec62 participates in protein translocation and calcium regulation.

  • Proximity labeling techniques: Methods like BioID or APEX2, adapted for S. pombe, could identify proteins that transiently interact with Sec62 during various cellular processes.

  • Single-molecule tracking: Applying super-resolution microscopy to track individual Sec62 molecules in live S. pombe cells could reveal dynamic aspects of its function.

  • Integrative multi-omics approaches: Combining transcriptomics, proteomics, and metabolomics in SEC62 mutant strains could provide a systems-level understanding of Sec62's impact on cellular physiology.

  • Optogenetic control: Developing tools for light-controlled activation or inhibition of Sec62 function would allow temporal precision in functional studies.

These technologies, when applied to the genetically tractable S. pombe system, promise to reveal new insights into Sec62's multifaceted roles in cellular homeostasis and protein translocation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.