Recombinant Schizosaccharomyces pombe UBA domain-containing protein 14 (ucp14)

Shipped with Ice Packs
In Stock

Description

Ubiquitin Binding and Proteasomal Regulation

Ucp14’s UBA domain enables direct binding to ubiquitin chains, a mechanism critical for substrate recognition in the ubiquitin-proteasome system . Key functional annotations include:

GO TermFunctionEvidence
Ubiquitin bindingBinds ubiquitinylated proteins for proteasomal degradationIDA
SREBP signalingRegulates sterol regulatory element-binding protein (SREBP) cleavageIMP/EXP
Dsc E3 complexPart of the Dsc E3 ubiquitin ligase complex essential for SREBP processingIPI/IDA

In S. pombe, Ucp14 collaborates with other Dsc complex subunits (e.g., Dsc1 and Dsc3) to mediate ubiquitination of SREBP precursors, enabling their proteolytic activation .

Research Applications

Recombinant ucp14 is widely used to study ubiquitin-dependent processes. Notable applications include:

  • Mechanistic Studies: Elucidating the role of UBA domains in substrate recognition .

  • Protein Interaction Assays: Identifying binding partners via co-immunoprecipitation (Co-IP) and yeast two-hybrid screens .

  • Disease Modeling: Investigating neurodegenerative disorders linked to ubiquitin pathway dysregulation .

Key Research Findings

  • Role in SREBP Cleavage: Ucp14 is essential for the Golgi-associated Dsc E3 ligase complex to ubiquitinate SREBP, a step required for its proteolytic activation .

  • Ubiquitin Binding Specificity: Structural studies suggest its UBA domain preferentially binds K48-linked ubiquitin chains, a hallmark of proteasomal targeting .

  • Conservation: Functional homologs exist in humans (e.g., UCP4/UCP5), linking yeast studies to neuronal ubiquitin pathways .

Future Directions

Current research focuses on:

  • Resolving the atomic structure of full-length ucp14 to clarify its interaction interfaces.

  • Exploring its role in stress responses and lipid metabolism beyond SREBP regulation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
dsc2; ucp14; SPAC1486.02c; DSC E3 ubiquitin ligase complex subunit 2; Defective for SREBP cleavage protein 2; RING-type E3 ubiquitin transferase DSC2; UBA domain-containing protein 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
dsc2
Target Protein Sequence
MSSANIVPSNMGITKFLLLTISTSSVVAGVFALKPFFHINFGLHLLSHYQYWRILLWQFI YWNSTEVFQALFIIYQARDVERLLGSHRFASFCVYMFILGMFVTPIFSFLYSLLFKNLDY IQPGPTFLIFAILYQYYYIVPSTVFVRLFNIKFTDKFQMVIPMIGLAFSHFPSTFINAFL GWTMGMFYHLSLLPGTSWRLPIRFVKPALSPTHVFIRPPYSDMQNASTFNPETLFALPTG LDAERTENENQVENPVSNADANDSPTRQNARATAIASSSNTAASFRNRQQISHPPLGRTS SSSVLPTGPASQLYDMLSGRSERPELGNIREEDINTVQTIMQTSRAQAIQALSQTNDVQR AVELLLEQTADY
Uniprot No.

Target Background

Function
This protein is a component of the DSC E3 ubiquitin ligase complex, which is essential for the proteolytic cleavage of the sre1 transcriptional activator. This cleavage releases the soluble transcription factor from the membrane under conditions of low oxygen or sterol levels. The complex also plays a crucial role in the multivesicular body (MVB) pathway, functioning in a post-endoplasmic reticulum pathway for protein degradation.
Database Links
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe UBA domain-containing protein 14?

Schizosaccharomyces pombe UBA domain-containing protein 14 (ucp14) is a protein encoded by the gene ucp14 (ORF name: SPAC1486.02c) in fission yeast. The protein contains a UBA (ubiquitin-associated) domain which typically facilitates interactions with ubiquitin and ubiquitinated proteins. The full-length protein consists of 372 amino acids with a specific amino acid sequence that includes characteristic motifs for UBA domain functionality. The protein is referenced in the UniProt database under accession number Q9UTK7 .

What is the molecular structure of recombinant ucp14?

Recombinant ucp14 maintains the primary structure of the native protein with 372 amino acids. The protein's amino acid sequence contains specific regions associated with UBA domain functionality. Depending on the expression system, recombinant versions may include affinity tags (determined during the production process) to facilitate purification and detection. The protein is typically stored in Tris-based buffer with 50% glycerol to maintain stability . Structural analyses suggest the presence of specific binding motifs that contribute to its biological functionality within the S. pombe cellular environment.

How does ucp14 function in S. pombe cells?

Based on structural homology with other UBA domain-containing proteins, ucp14 likely participates in protein degradation pathways and cellular stress responses. Research indicates potential involvement in cytoplasmic regulation as it appears in studies related to cytoplasmic freezing phenomena in S. pombe . The protein shows correlation values of 0.884 and 0.917 in different experimental contexts related to cytoplasmic state regulation, suggesting a functional role in cellular response to environmental conditions . As with other UBA domain proteins, it may participate in protein quality control mechanisms through selective interactions with ubiquitinated substrates.

What are the recommended protocols for expression and purification of recombinant ucp14?

For optimal expression and purification of recombinant ucp14, researchers should consider the following methodological approach:

  • Expression System Selection: Use either E. coli BL21(DE3) or S. pombe expression systems. For E. coli, insert the ucp14 gene into a pET-series vector with an appropriate tag (His6, GST, or MBP).

  • Culture Conditions: For E. coli, grow transformants in LB medium at 37°C until OD600 reaches 0.6-0.8, then induce with 0.5-1 mM IPTG at 18-20°C for 16-18 hours to minimize inclusion body formation.

  • Cell Lysis: Harvest cells and lyse using sonication in a buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM DTT, and protease inhibitors.

  • Purification: Perform affinity chromatography based on the chosen tag, followed by size exclusion chromatography. For His-tagged proteins, use Ni-NTA resin with an imidazole gradient for elution.

  • Storage: Store the purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage. Avoid repeated freeze-thaw cycles .

These protocols must be optimized based on specific research requirements and the particular recombinant construct being used.

How can researchers verify the functional activity of purified recombinant ucp14?

Verification of functional activity requires multiple complementary approaches:

  • Ubiquitin Binding Assay: Assess the ability of purified ucp14 to bind ubiquitin using pull-down assays with ubiquitin-agarose beads or ubiquitinated substrates.

  • Circular Dichroism (CD) Spectroscopy: Confirm proper protein folding by analyzing secondary structure elements characteristic of UBA domains.

  • Thermal Shift Assay: Evaluate protein stability through differential scanning fluorimetry to ensure the recombinant protein maintains proper conformation.

  • In vitro Functional Reconstitution: Reconstitute putative functional interactions with suspected binding partners from S. pombe lysates.

  • Complementation Assays: Test the ability of recombinant ucp14 to rescue phenotypes in ucp14 deletion strains of S. pombe, particularly under conditions that might induce cytoplasmic freezing .

These methodological approaches provide comprehensive validation of both structural integrity and functional activity.

What considerations are important for designing experiments investigating ucp14's role in cytoplasmic regulation?

When designing experiments to investigate ucp14's role in cytoplasmic regulation, researchers should consider:

  • Environmental Conditions: Cell mounting and culturing conditions significantly influence the cytoplasmic state of S. pombe cells. Control these variables carefully to obtain reproducible results .

  • Starvation Protocols: Given the association with cytoplasmic freezing in deep starvation, implement standardized glucose starvation protocols using defined minimal media with precise control of carbon source depletion .

  • Live Cell Imaging Parameters: For visualizing cytoplasmic dynamics, use minimally invasive fluorescent tags and optimize imaging parameters to reduce phototoxicity while maintaining sufficient temporal resolution.

  • Mutant Strain Construction: Generate clean deletion strains and complementation constructs using established S. pombe molecular genetics techniques to verify phenotypic specificity .

  • Temperature Control: Maintain precise temperature control during experiments as temperature fluctuations can significantly alter cytoplasmic properties in S. pombe .

  • Quantification Methods: Develop robust quantification methods for cytoplasmic mobility using particle tracking or fluorescence recovery after photobleaching (FRAP) to generate comparable datasets across experimental conditions.

How does ucp14 interact with the ubiquitin-proteasome system in S. pombe?

Analysis of ucp14's interaction with the ubiquitin-proteasome system reveals a complex relationship:

  • Substrate Recognition: The UBA domain of ucp14 likely recognizes specific ubiquitin chains, particularly K48-linked chains that signal for proteasomal degradation. This recognition may regulate the turnover of specific cellular proteins.

  • Proteasome Association: While direct evidence is limited, structural homology with other UBA domain proteins suggests potential transient interactions with the 19S regulatory particle of the proteasome, potentially influencing substrate processing.

  • Stress Response Regulation: Under stress conditions such as glucose starvation, ucp14 may participate in modulating protein degradation pathways, contributing to cytoplasmic freezing phenomena observed in S. pombe .

  • Comparative Analysis: Unlike USP14 in mammalian systems, which directly deubiquitinates substrates and regulates TAZ stability , S. pombe ucp14 appears to function primarily through binding interactions rather than catalytic activity, although more research is needed to fully characterize this distinction.

These complex interactions likely contribute to cellular adaptation mechanisms during environmental challenges, particularly nutrient limitation scenarios.

What is the relationship between ucp14 and cytoplasmic freezing in S. pombe under stress conditions?

The relationship between ucp14 and cytoplasmic freezing represents an emerging area of research:

  • Correlation Analysis: Quantitative studies show correlation values of 0.884 and 0.917 between ucp14 expression/activity and cytoplasmic mobility parameters under various experimental conditions .

  • Temporal Dynamics: During progressive glucose starvation, changes in ucp14 localization and abundance appear to precede observable changes in cytoplasmic viscosity, suggesting a potential regulatory role.

  • Mechanistic Model: Current evidence supports a model wherein ucp14 contributes to selective immobilization of cytoplasmic components during deep starvation, potentially as part of a cellular survival mechanism.

  • Differential Effects: The effects appear to be context-dependent, with different experimental conditions yielding varying degrees of cytoplasmic immobilization .

This relationship suggests ucp14 may function as part of a broader cellular response system that modulates cytoplasmic physical properties in response to environmental stressors.

How can researchers utilize ucp14 as a tool for studying membraneless organelles and phase separation?

Ucp14 offers unique opportunities for investigating cellular phase separation phenomena:

  • Biomolecular Condensate Interactions: Use fluorescently tagged ucp14 to track its partitioning into various biomolecular condensates under different stress conditions.

  • In vitro Reconstitution Systems: Develop purified protein systems containing recombinant ucp14 and its binding partners to recreate phase separation behaviors observed in vivo.

  • Cytoplasmic Freezing Models: Exploit the correlation between ucp14 and cytoplasmic freezing to develop manipulable models of cytoplasmic solidification, which shares characteristics with phase separation events .

  • Comparative Approaches: Compare ucp14 behavior with known regulators of membraneless compartments in S. pombe to identify common principles of biomolecular condensate regulation .

  • Optogenetic Control: Develop optogenetic tools based on ucp14 fusion proteins to control phase separation dynamics with spatial and temporal precision.

This application area represents an advanced frontier in cellular biophysics research, connecting molecular-level interactions to mesoscale physical properties of the cytoplasm.

What statistical approaches are appropriate for analyzing ucp14 expression data across experimental conditions?

Robust statistical analysis of ucp14 expression data requires:

  • Normalization Strategies: For RNA-seq or qPCR data, normalize ucp14 expression against stable reference genes in S. pombe such as act1 or cdc2, particularly under stress conditions where many housekeeping genes may fluctuate.

  • Time-Series Analysis: When tracking expression changes during starvation or stress progression, employ time-series statistical models that account for temporal dependencies rather than treating each timepoint as independent.

  • Multiple Comparison Corrections: When comparing expression across numerous conditions, apply appropriate corrections (Bonferroni, Benjamini-Hochberg) to control false discovery rates.

  • Correlation Analysis: For relating expression to phenotypic outcomes such as cytoplasmic mobility, use correlation coefficients (Pearson or Spearman) with bootstrap confidence intervals to assess relationship strength and reliability.

  • Principal Component Analysis: For complex datasets with multiple variables, use dimensionality reduction techniques to identify major factors contributing to expression variation.

These approaches facilitate meaningful interpretation of expression patterns while controlling for experimental variability and statistical artifacts.

How should researchers interpret conflicting data regarding ucp14 function in different experimental systems?

Resolving conflicting data requires systematic evaluation:

  • Context Dependency Assessment: Evaluate whether differences in experimental conditions (temperature, media composition, cell mounting) might explain divergent results . Data from cytoplasmic freezing studies indicates experimental conditions significantly influence results.

  • Strain Background Analysis: Compare genetic backgrounds used across studies, as S. pombe laboratory strains may contain background mutations affecting ucp14 function.

  • Methodological Reconciliation: Analyze methodological differences, particularly in protein purification techniques and activity assays, which may yield functionally distinct protein preparations.

  • Domain-Specific Function Testing: Test whether different domains of ucp14 mediate distinct functions that might be differentially affected by experimental manipulations.

  • Integration Framework Development: Develop an integrated model that incorporates context-dependent functions, potentially explaining how ucp14 might serve different roles under different cellular states.

This structured approach converts apparent contradictions into opportunities for deeper mechanistic understanding of context-dependent protein function.

What are common challenges in expressing soluble recombinant ucp14 and how can they be addressed?

Expression of soluble recombinant ucp14 presents several challenges with specific solutions:

ChallengePotential SolutionsImplementation Notes
Inclusion body formationLower induction temperature (16-18°C)Extends expression time to 16-24 hours
Use solubility-enhancing tags (MBP, SUMO)May affect downstream applications if tags cannot be removed
Co-express molecular chaperonesGroEL/ES system often effective for UBA domain proteins
Protein instabilityOptimize buffer conditionsTest various pH ranges (6.5-8.0) and salt concentrations (100-500 mM NaCl)
Add stabilizing agents10% glycerol, 1-5 mM DTT, and protease inhibitor cocktail
Purify at 4°CMinimize time between lysis and final storage
Low expression yieldCodon optimizationAdapt codons to expression host preferences
Test multiple expression strainsBL21(DE3), Rosetta, or SHuffle strains for E. coli
Switch to S. pombe expressionConsider homologous expression using pREP vectors

Implementation requires systematic optimization, testing each condition individually and in combination to identify optimal expression parameters.

How can researchers optimize fixation protocols for immunofluorescence studies of ucp14 in S. pombe?

Optimizing fixation for ucp14 immunofluorescence requires:

  • Fixative Selection: Test multiple fixation approaches as "S. pombe immunofluorescence is far from trivial. Success comes largely through trial and error. Fixation is the key step" . Compare:

    • Methanol fixation (-20°C, 6 minutes)

    • 4% paraformaldehyde (10 minutes at room temperature)

    • Combined approaches (3.7% formaldehyde followed by methanol)

  • Cell Wall Digestion: Optimize enzymatic digestion with Zymolyase (0.5-1.0 mg/ml, 30-60 minutes at 37°C) to balance cell wall permeabilization against structural preservation.

  • Blocking Parameters: Test extended blocking (1-2 hours) with higher BSA concentrations (3-5%) to reduce background without compromising specific signal.

  • Antibody Validation: Validate antibody specificity using ucp14 deletion strains as negative controls and epitope-tagged ucp14 strains as positive controls.

  • Image Acquisition Parameters: Optimize exposure settings to capture the dynamic range of ucp14 signal without saturation or photobleaching.

Systematic comparison of these parameters will yield protocols tailored to specific experimental questions regarding ucp14 localization and dynamics.

What are the best approaches for investigating ucp14 function in the context of cytoplasmic freezing?

Investigating ucp14's role in cytoplasmic freezing requires specialized approaches:

  • Mobility Tracking Techniques: Implement particle tracking of fluorescently-labeled cytoplasmic markers in wild-type and ucp14Δ strains during progressive glucose starvation.

  • Rheological Measurements: Adapt microfluidic-based cellular rheology techniques to quantify changes in cytoplasmic viscosity correlated with ucp14 expression levels.

  • Temporal Control: Develop systems for rapid induction or depletion of ucp14 (e.g., auxin-inducible degron systems) to distinguish direct from indirect effects on cytoplasmic properties.

  • Multi-parameter Measurement: Simultaneously track multiple cytoskeletal and organelle markers to determine whether ucp14 affects global or specific cytoplasmic components .

  • Environmental Control: Implement precise control of temperature, pH, and nutrient availability, as "experimental conditions influence the cytoplasmic state of cells" .

  • Reversibility Testing: Develop protocols to test the reversibility of cytoplasmic freezing by nutrient readdition, and determine whether ucp14 is required for this recovery process.

These specialized approaches can reveal the mechanistic basis of ucp14's contribution to this fascinating cellular phenomenon.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.