Recombinant Schizosaccharomyces pombe Uncharacterized acyltransferase vps66 (vps66)

Shipped with Ice Packs
In Stock

Description

Production and Purification

vps66 is produced via recombinant DNA technology in E. coli, leveraging its robust expression system. Post-expression, the His-tagged protein is purified using affinity chromatography.

ParameterSpecification
Expression SystemBacterial (E. coli)
Purification MethodAffinity chromatography (His-tag)
FormLyophilized powder
ConcentrationReconstituted to 0.1–1.0 mg/mL (deionized sterile water recommended)

Research Applications

vps66 is utilized in structural and functional studies, particularly in:

Enzymatic Activity Assays

Though not fully characterized, vps66’s putative role as an LPAAT suggests involvement in lipid metabolism. Potential applications include:

  • In vitro acyltransferase activity testing: Assessing substrate specificity for lysophospholipids.

  • Interaction studies: Identifying partners in vacuolar sorting pathways .

Immunological Tools

  • Antibody development: Rabbit polyclonal antibodies (IgG isotype) are available for ELISA and Western blot detection .

  • ELISA kits: Recombinant vps66 serves as a coating antigen in immunoassays for quantifying endogenous protein levels .

Functional and Pathway Insights

vps66 is linked to vacuolar protein sorting (VPS), a process critical for cellular trafficking. While its exact role remains unclear, homology to LPAATs implies a role in lipid remodeling. Further studies are needed to:

  • Determine enzymatic activity (e.g., transferring acyl groups to lysophosphatidic acid).

  • Map interactions with VPS-associated proteins (e.g., via yeast two-hybrid or co-IP) .

Challenges and Considerations

  • Uncharacterized function: Limited biochemical data necessitates caution in interpretation.

  • Source variability: Partial recombinant variants (e.g., truncated forms) may differ in activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted based on your requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
vps66; SPAC1783.02c; Putative lysophosphatidic acid:oleoyl-CoA acyltransferase; LPAAT; Lysophosphatidic acid acyltransferase; Vacuolar protein sorting-associated protein 66
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
vps66
Target Protein Sequence
MLDCSHKCCLNRTQKKIKAKNRSQLFCIMILDFKIEYPGTGIAPFHPINTETPSGFNFKW ILIVVVMILRVPLCIISVTLWFLWSCFLKPILSIQPKLSFFIDSSLSRLLLLCFGCLKLS KSTSGSFVQGDSLQPGDILAVNHSSPLDVLVLSCLYNCTFAVCDSKTSNVSIISAQAYFW SCFFSPSKLKITDAKPLAKVAAKASKIGTVVILFPEGVCTNGRALCQFTPCFDSAKETDR IFPLYIKYLPPCVTLPVPSLLSFARSVLLTVSFEIRIRFSAEPLIPRNCTDVTESAQEVL SKLGRSRVVKLGKSDKLSYLDARSKKHV
Uniprot No.

Target Background

Function
Acyl-CoA-dependent lysophosphatidic acid acyltransferase showing a preference for oleoyl-CoA. It plays a role in triacylglyceride homeostasis, lipid droplet formation, and vacuolar protein sorting.
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Lipid droplet. Endoplasmic reticulum membrane; Single-pass membrane protein. Golgi apparatus membrane; Single-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe and why is it valuable for studying uncharacterized proteins like vps66?

Schizosaccharomyces pombe is a rod-shaped unicellular eukaryote that has become an increasingly important model organism over the past 50 years. Unlike Saccharomyces cerevisiae, S. pombe shares more common features with humans, including gene structures, chromatin dynamics, and the prevalence of introns, making it an excellent system for investigating conserved biological processes .

S. pombe is particularly valuable for studying uncharacterized proteins like vps66 for several reasons:

  • Genetic tractability: The nearly isogenic background of all laboratory strains enhances data consistency across different research groups .

  • Conserved features: Out of 5,064 total protein-coding genes in fission yeast, 3,536 have human homologs, with 1,244 being disease-associated genes .

  • Simplified genome: S. pombe lacks large-scale genome duplications seen in other eukaryotes, making it easier to study individual gene functions .

  • Versatile ploidy: The ability to work with both haploid and diploid states allows for powerful genetic analyses of recessive traits and gene dosage effects .

The experimental advantages of S. pombe make it an ideal system to characterize vps66, as researchers can employ both forward and reverse genetic approaches with relative ease.

What are acyltransferases and what general functions might vps66 serve in S. pombe?

Acyltransferases constitute a diverse family of enzymes that catalyze the transfer of acyl groups from donor molecules to acceptor substrates. In eukaryotic cells like S. pombe, acyltransferases typically participate in:

  • Lipid metabolism and membrane biogenesis

  • Protein modification and trafficking

  • Cell wall synthesis and maintenance

  • Secondary metabolite production

As an uncharacterized acyltransferase, vps66 likely plays a role in one or more of these processes. The "vps" designation (vacuolar protein sorting) suggests potential involvement in vesicular trafficking pathways. Based on S. pombe's distinctive cellular characteristics, vps66 may function in:

  • Maintaining cell polarity during the characteristic rod-shaped growth

  • Facilitating membrane remodeling during cell division

  • Contributing to organelle integrity, particularly vacuolar/endosomal systems

  • Participating in post-translational modifications of proteins involved in cell cycle regulation

A systematic approach to characterizing vps66 would include subcellular localization studies, phenotypic analysis of deletion mutants, and identification of interacting partners through proteomic approaches.

What expression systems are most effective for producing recombinant vps66 in S. pombe?

For successful expression of recombinant vps66 in S. pombe, researchers should consider the following expression systems, each with distinct advantages:

Expression SystemPromoterInduction MethodYieldBest Application
pREP seriesnmt1 (no message in thiamine)Thiamine depletionHighStrong, regulated expression with minimal leakiness
pJK148-basedadh1ConstitutiveModerateStable, consistent expression
pDUAL vectorsadh1 or nmt1Constitutive or regulatedVariableIntegration at defined loci for consistent copy number
pTN-L1 systemLEU1 or ura4ConstitutiveModerateN- or C-terminal tagging with fluorescent proteins

When expressing vps66, consider these methodological approaches:

  • Codon optimization: Analyze the vps66 sequence for rare codons in S. pombe and optimize if necessary to enhance expression.

  • Tag selection: Choose tags (His, FLAG, GFP) based on downstream applications. For acyltransferases like vps66, C-terminal tags are often preferable to avoid disrupting potential N-terminal targeting sequences.

  • Expression timing: The thiamine-repressible nmt1 promoter allows precise control of expression timing, which is particularly valuable when studying potentially toxic proteins or those involved in cell cycle regulation .

  • Integration strategy: For consistent expression levels, genomic integration at a neutral locus is recommended over episomal vectors, particularly when conducting quantitative analyses.

The ability to manipulate S. pombe through both mitotic and meiotic cycles provides additional flexibility for establishing stable expression strains through controlled genetic crosses .

What genetic approaches are most effective for functional characterization of vps66 in S. pombe?

For comprehensive functional characterization of vps66, a multi-faceted genetic approach is recommended:

  • CRISPR-Cas9 Gene Editing: Generate precise mutations in functional domains of vps66 to assess structure-function relationships. This approach is superior to random mutagenesis for acyltransferases, as it can target predicted catalytic residues based on structural homology modeling.

  • Synthetic Genetic Array (SGA) Analysis: Systematically create double mutants between vps66 and other genes to identify genetic interactions. This approach has revealed that many uncharacterized genes in S. pombe show synthetic lethality with components of:

    • DNA replication machinery

    • Chromatin remodeling complexes

    • Cell cycle regulators

  • Auxin-inducible Degron (AID) System: Engineer vps66 with an AID tag for rapid protein depletion upon auxin addition, allowing temporal studies of vps66 function without the temperature shift that can affect other cellular processes.

  • Heterologous Expression: Test functionality of vps66 homologs from other species in a vps66Δ S. pombe strain to assess evolutionary conservation of function.

The cell cycle characteristics of S. pombe provide a particularly powerful context for these studies, as cell morphology changes can be directly correlated with cell cycle progression, allowing researchers to visually assess the impact of vps66 perturbation on cell cycle phases .

How can researchers overcome challenges in purifying and biochemically characterizing vps66?

Membrane-associated proteins like acyltransferases present significant challenges for biochemical characterization. For vps66, implement these advanced strategies:

  • Optimized Solubilization Protocol:

Detergent TypeConcentration RangeBest for
Digitonin0.5-1.0%Preserving protein-protein interactions
DDM0.05-0.1%General solubilization with mild conditions
CHAPS0.5-1.0%Maintaining enzymatic activity
SDS0.1-0.5%Complete denaturation (for Western blotting)
  • Advanced Expression Strategies:

    • Use the S. pombe nmt1 promoter system with varying strengths (full, medium, low) to optimize expression level without toxicity

    • Express truncated versions lacking transmembrane domains while preserving catalytic domains

    • Co-express with potential binding partners identified through genome-wide studies

  • Activity Assays:

    • Develop in vitro acyltransferase assays using radiolabeled or fluorescently labeled acyl donors

    • Implement mass spectrometry-based approaches to identify specific acylation sites on target proteins

    • Establish cell-based assays using S. pombe's genetic tractability, such as suppressor screens of vps66Δ phenotypes

  • Structural Analysis Approaches:

    • Cryo-electron microscopy of purified complexes

    • X-ray crystallography of soluble domains

    • NMR analysis of lipid-protein interactions

  • Proteomics Integration:

    • Develop a substrate trap version of vps66 (catalytically inactive) to capture transient interactions

    • Use proximity labeling (BioID or APEX) to identify neighboring proteins in the native cellular environment

S. pombe offers unique advantages for these approaches due to its relatively simple proteome and the availability of comprehensive deletion libraries for validation studies .

What approaches can be used to resolve contradictory data when studying vps66 function in different genetic backgrounds?

When encountering contradictory results in vps66 functional studies across different S. pombe strains, implement these methodological approaches:

  • Standardize Genetic Backgrounds:

    • Return to the original Leupold isolates (968 h⁹⁰, 972 h⁻, and 975 h⁺) from which most laboratory strains are derived

    • Create a reference panel of vps66 mutants in these standardized backgrounds

    • Systematically document all genetic modifications in experimental strains

  • Control for Secondary Mutations:

    • Perform whole-genome sequencing of contradictory strains to identify background mutations

    • Implement genetic backcrossing to clean genetic backgrounds (minimum 3 backcrosses)

    • Use tetrad analysis to correlate phenotypes precisely with the vps66 genotype

  • Quantitative Phenotyping:

Phenotypic AssayMeasurementRelevance to vps66 Function
Cell length measurementMicroscopy with precise cell length quantificationCell cycle progression defects
Vacuolar morphologyFM4-64 staining and confocal microscopyVacuolar protein sorting function
Membrane compositionLipidomic analysis by mass spectrometryLipid acylation activity
Protein localizationFluorescence microscopy of GFP-tagged proteinsImpact on protein trafficking
  • Environmental Standardization:

    • Control media composition precisely, as S. pombe phenotypes can be sensitive to subtle differences

    • Standardize temperature conditions, particularly important for temperature-sensitive mutants

    • Document cell density at time of analysis, as some phenotypes are cell-density dependent

  • Statistical Approaches:

    • Implement multiple comparison corrections appropriate for the scale of analysis

    • Use meta-analysis techniques to integrate results across different studies

    • Apply Bayesian approaches to update confidence in hypotheses as new data emerges

  • Leverage S. pombe Community Resources:

    • Contribute to and utilize the PomBase community platform to share contradictory results

    • Implement the FYPO (Fission Yeast Phenotype Ontology) for standardized phenotype reporting

This systematic approach takes advantage of S. pombe's uniform isogenic background to resolve contradictions and establish reproducible findings about vps66 function.

What are the optimal experimental conditions for assessing vps66 deletion phenotypes in S. pombe?

To comprehensively characterize phenotypes associated with vps66 deletion, implement this multi-faceted experimental design:

  • Growth Condition Matrix:

Media TypeTemperatureStress ConditionAnalysis Timepoint
YES (rich)25°C, 30°C, 36°CStandard growthLog phase, stationary phase
EMM (minimal)25°C, 30°C, 36°CStandard growthLog phase, stationary phase
YES + 1M KCl30°COsmotic stress1h, 4h, 12h post-stress
YES + 10mM HU30°CReplication stress1h, 4h, 12h post-stress
YES + 0.005% MMS30°CDNA damage1h, 4h, 12h post-stress
EMM - nitrogen30°CNitrogen starvation1h, 4h, 12h post-starvation
  • Phenotypic Readouts:

    • Growth rate (doubling time) measurements

    • Cell morphology analysis (length, width, septation index)

    • Fluorescent microscopy for subcellular structures (vacuoles, endosomes, Golgi)

    • Flow cytometry for cell cycle distribution

    • Electron microscopy for ultrastructural features

  • Genetic Background Considerations:

    • Generate vps66Δ in both h⁺ and h⁻ mating types to assess mating efficiency

    • Create homozygous and heterozygous diploid vps66Δ strains to evaluate dosage effects

    • Implement the vps66 deletion in both laboratory strains and natural isolates to assess phenotypic penetrance

  • Cell Cycle Synchronization:

    • Use nitrogen starvation and release for analyzing specific cell cycle phases

    • Implement the cdc25-22 temperature-sensitive background for G2 synchronization

    • Apply hydroxyurea block and release for S-phase analysis

  • Suppressor Analysis:

    • Screen for spontaneous suppressors of vps66Δ phenotypes

    • Perform targeted suppression analysis with known acyltransferase pathway components

    • Implement synthetic genetic array analysis to identify genetic interactors

This approach leverages S. pombe's uniform cell size at division under defined conditions, allowing precise correlation of phenotypes with cell cycle progression , which is particularly valuable when studying genes potentially involved in membrane dynamics during cell division.

What strategies can researchers employ to identify substrates and interacting partners of vps66?

Identifying the substrates and interacting partners of vps66 requires a multi-faceted approach tailored to acyltransferases:

  • Affinity Purification Approaches:

MethodAdvantagesConsiderations for vps66
Tandem Affinity Purification (TAP)High purity, reduced backgroundMay disrupt membrane associations
BioID proximity labelingCaptures transient interactionsWorks in native cellular environment
APEX2 proximity labelingHigh temporal resolutionCan be targeted to specific compartments
Cross-linking Mass SpectrometryCaptures direct interactionsRequires optimization for membrane proteins
  • Substrate Identification Strategies:

    • Develop a substrate-trapping mutant of vps66 (catalytically inactive but substrate-binding)

    • Implement comparative acylome profiling between wild-type and vps66Δ strains

    • Use click chemistry approaches with alkyne-fatty acids to label and purify acylated proteins

  • Genetic Interaction Mapping:

    • Perform synthetic genetic array (SGA) analysis with vps66Δ as query against the S. pombe deletion library

    • Implement E-MAP (Epistatic Mini Array Profile) to quantify genetic interactions

    • Conduct dosage suppressor screens to identify genes that when overexpressed suppress vps66Δ phenotypes

  • S. pombe-Specific Considerations:

    • Leverage S. pombe's ability to form stable diploids for complementation studies

    • Utilize the well-characterized mating and sporulation pathways to create complex genetic backgrounds

    • Implement cell cycle synchronization to capture cell cycle-specific interactions

  • Validation Approaches:

    • Confirm direct interactions using recombinant proteins in vitro

    • Verify colocalization by fluorescence microscopy

    • Demonstrate functional relationships through epistasis analysis

This comprehensive approach takes advantage of S. pombe's genetic tractability and the ability to manipulate its life cycle between haploid and diploid states , providing multiple independent methods to confirm true interacting partners and substrates.

How can insights from vps66 research in S. pombe be translated to understand human disease mechanisms?

Research on vps66 in S. pombe provides valuable insights for human disease studies for several reasons:

  • Conservation of Core Cellular Processes:

    • S. pombe shares 3,536 genes with human homologs, including 1,244 disease-associated genes

    • Fundamental processes involving acyltransferases are conserved from yeast to humans

    • S. pombe cellular architecture more closely resembles human cells than S. cerevisiae in several aspects

  • Disease Relevance of Acyltransferases:

Human DiseasePotential vps66 ConnectionS. pombe Model Advantage
NeurodegenerationProtein aggregation modulated by acylationSimplified system for mechanistic studies
CancerCell cycle dysregulationWell-characterized cell cycle control system
Metabolic disordersLipid metabolism defectsConserved core metabolic pathways
Developmental disordersProtein trafficking defectsBasic trafficking machinery conservation
  • Translational Research Approaches:

    • Identify human homologs of vps66 through sequence and structural analysis

    • Test functional conservation through cross-species complementation

    • Create humanized S. pombe strains expressing human vps66 homologs

    • Model disease-associated mutations in the S. pombe system

  • S. pombe as a Drug Discovery Platform:

    • Develop phenotypic screens based on vps66 mutant phenotypes

    • Implement chemical genetic approaches to identify compounds targeting vps66-related pathways

    • Use S. pombe to assess specificity of acyltransferase inhibitors

  • Technological Translation:

    • Adapt methodologies developed in S. pombe for use in human cell culture systems

    • Apply insights from genetic interaction networks to predict effects in human cells

    • Utilize conservation of RNAi and epigenetic mechanisms to develop targeted interventions

This approach leverages S. pombe's position as a "micromammal" with significant conservation of biological processes relevant to human disease, while offering the experimental advantages of a unicellular model organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.