Recombinant Schizosaccharomyces pombe Uncharacterized amino-acid permease C9.10 (SPAC9.10)

Shipped with Ice Packs
In Stock

Description

Functional Classification

SPAC9.10 is annotated as a thiamine transporter but shares homology with the Amino Acid-Polyamine-Organocation (APC) superfamily (TC# 2.A.3) . Members of this superfamily typically function as:

  • Proton-coupled symporters (e.g., lysine uptake in Saccharomyces cerevisiae Gap1)

  • Broad-specificity transporters for amino acids, polyamines, or organocations

Structural modeling suggests SPAC9.10 may employ mechanisms akin to APC transporters like ApcT, where conserved residues (e.g., Lys158 in ApcT) facilitate proton-coupled transport .

Genomic and Proteomic Context

  • Gene Essentiality: thi9 (SPAC9.10) was classified as non-essential in genome-wide deletion studies, suggesting functional redundancy or condition-specific necessity .

  • Proteomic Interactions: Comparative proteome analyses in S. pombe indicate that amino acid permeases influence membrane composition and secretory capacity, though direct data on SPAC9.10 remains limited .

Research Applications

This recombinant protein enables:

  1. Transport Mechanism Studies: Structural resolution of SPAC9.10 could clarify its role in thiamine or amino acid uptake, analogous to Arabidopsis AAPs .

  2. Membrane Protein Modeling: Its production in E. coli provides a tractable system for studying eukaryotic transporter folding and stability .

  3. Biotechnological Engineering: Insights from S. pombe secretion pathways may inform optimization of SPAC9.10 for industrial protein production.

Technical Considerations for Use

ParameterRecommendation
ReconstitutionUse deionized sterile water (0.1–1.0 mg/mL) with 50% glycerol for storage
AvoidancesRepeated freeze-thaw cycles; exposure to reducing agents
Activity ValidationFunctional assays (e.g., radiolabeled substrate uptake) required for confirmation

Unresolved Questions and Future Directions

  • Substrate Specificity: While annotated as a thiamine transporter , experimental validation of SPAC9.10’s primary substrates is lacking.

  • Regulatory Role: APC transporters like Agp2 in S. cerevisiae regulate downstream gene expression ; analogous signaling functions in S. pombe warrant exploration.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
thi9; SPAC9.10; Thiamine transporter thi9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
thi9
Target Protein Sequence
MPSSQISHQDPELGQTSSGSSSIKEKAEPQLYAGPIDPARRPDVFQEGFEDVSVTDDDND NELLRKMGYQPVLHRSFEFFESFAASFASLDVVSGVRLTFSWGISFGGPAAYWSAMLVTG FCSIVTAACLAEICSALPAAGSIYLWAAESAGPRFGRFVSFLVAWWSTTAWTTFVASITQ STANFIFAEVSTFNNPWPTNDSDVKFRAVQWIVAEVLLVFTILLNQVPPRYYKWIFKASM LLMFIDYVMNIIWVPVATSKKPDGFRSAKWVFTETIYDQAGYIKEVDDANGNPIASLSKI VPKGWQWCLSYFATAGVIVGYDASGHIAEETKDASIKAARGIFYSTVTSFIVAFSLAILY LFCCPDLDTFTAILYNDNSPQPFVNFYSYLLGRGGHVVMNVVIILEIFLNGVVSVLACSR LVFAVSRDGVLPFSNWISQVSKTGQPKNAITVIYIVSALLLCTILPSAVAFTSLVSAAGA PSFAAYAVLAFCRLFITRDKFPKGRWSLGWLSKPCLVITLVYNLFALVVNVSPYTYPVTG PSFNYAVVIMGGVSIFAIICTIVIPKSRWVANRYRYESDSEHSASVKELKV
Uniprot No.

Target Background

Function
This thiamine transporter is involved in the cellular uptake of thiamine. Pyrithiamine, oxythiamine, amprolium, and the thiazole part of thiamine have been shown to be substrates of thi9.
Database Links
Protein Families
Amino acid-polyamine-organocation (APC) superfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for producing Recombinant S. pombe amino-acid permease C9.10?

For optimal expression of S. pombe proteins, E. coli expression systems are commonly employed due to their efficiency and scalability. Based on established protocols for similar S. pombe uncharacterized proteins, the recommended approach involves cloning the full-length coding sequence (1-676 aa) with an N-terminal His tag to facilitate purification . The expression vector should contain a strong promoter compatible with bacterial expression systems. The following expression conditions have been found to yield high protein quality:

ParameterRecommended Condition
Expression HostE. coli BL21(DE3)
Induction0.5 mM IPTG
Temperature18°C post-induction
Duration16-20 hours
MediaLB supplemented with appropriate antibiotics

To confirm successful expression, always validate using SDS-PAGE and Western blot analysis with anti-His antibodies to ensure integrity of the expressed protein .

How should researchers store and handle purified Recombinant S. pombe amino-acid permease C9.10?

Proper storage and handling are critical for maintaining protein integrity. The purified protein should be stored as a lyophilized powder for long-term stability . For working aliquots, reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, supplemented with 5-50% glycerol (with 50% being the standard concentration) . The reconstituted protein should be:

  • Aliquoted in small volumes to minimize freeze-thaw cycles

  • Stored at -20°C/-80°C for long-term storage

  • Maintained at 4°C for working aliquots, but only for up to one week

  • Protected from repeated freeze-thaw cycles, which significantly reduce activity

For buffer composition, a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 has been demonstrated to maintain stability of similar S. pombe recombinant proteins .

What purification methods yield the highest purity for Recombinant S. pombe amino-acid permease C9.10?

For His-tagged S. pombe amino-acid permease, a multi-step purification protocol is recommended to achieve purity greater than 90%:

Purification StepDetailsPurpose
Initial CaptureNi-NTA affinity chromatographyCaptures His-tagged protein
Intermediate PurificationIon exchange chromatographyRemoves contaminating proteins
PolishingSize exclusion chromatographyEliminates aggregates and ensures homogeneity
Quality ControlSDS-PAGE analysisConfirms purity >90%

During purification, include protease inhibitors in all buffers and maintain temperature at 4°C to prevent degradation. For membrane proteins like amino-acid permeases, consider including mild detergents such as DDM (n-Dodecyl β-D-maltoside) or CHAPS to maintain solubility during purification processes .

How should researchers design controlled experiments to investigate the function of S. pombe amino-acid permease C9.10?

When designing experiments to investigate the function of uncharacterized proteins like S. pombe amino-acid permease C9.10, employ a true experimental design following these methodological principles:

  • Identify specific independent variables (e.g., substrate concentration, pH, temperature) to manipulate

  • Implement proper control conditions (positive, negative, and vehicle controls)

  • Randomly assign experimental units to different treatment levels

  • Control for extraneous variables that might affect permease function

Experimental research is most appropriate for establishing cause-effect relationships in the function of the amino-acid permease . Consider both laboratory experiments (high internal validity) and field experiments (higher external validity) depending on your research questions .

Experimental Design ElementImplementation for Amino-acid Permease Studies
Independent VariablesSubstrate concentrations, pH, competitive inhibitors
Dependent VariablesTransport rates, substrate specificity, kinetic parameters
ControlsKnown permeases, vector-only transformants, inactive mutants
RandomizationRandom assignment of samples to treatment groups
ReplicationMinimum technical triplicates and biological duplicates

Remember that experimental research is best suited for explanatory research (examining cause-effect relationships) rather than descriptive or exploratory research .

What are the best methods for characterizing substrate specificity of S. pombe amino-acid permease C9.10?

Characterizing substrate specificity requires a methodical approach combining in vitro and in vivo techniques:

  • Radiotracer Uptake Assays: Measure uptake of radioactively labeled amino acids to determine transport capabilities

    • Utilize 3H^{3}H or 14C^{14}C-labeled amino acids

    • Test with a panel of all 20 standard amino acids

    • Include non-standard amino acids to identify unique specificities

  • Competition Assays: Measure inhibition of transport of a known substrate in the presence of potential competitive substrates

  • Kinetic Analysis: Determine KmK_m and VmaxV_{max} values for each transported substrate:

    V=Vmax[S]Km+[S]V = \frac{V_{max} \cdot [S]}{K_m + [S]}

  • Growth Complementation Assays: Express the permease in S. pombe strains auxotrophic for specific amino acids and assess growth restoration

For all experiments, implement appropriate controls including known amino acid permeases with well-characterized specificity profiles and empty vector controls to account for endogenous transport activities .

How can researchers design experiments to determine the subcellular localization of S. pombe amino-acid permease C9.10?

Determining subcellular localization requires a multi-faceted experimental approach:

  • Fluorescence Microscopy:

    • Generate GFP/RFP fusion constructs with the C9.10

    • Express in S. pombe cells

    • Co-localize with established organelle markers (plasma membrane, vacuole, endosomes)

    • Use time-lapse microscopy to track dynamic localization changes

  • Subcellular Fractionation:

    • Separate cellular components through differential centrifugation

    • Detect protein in fractions using Western blotting with anti-His antibodies

    • Compare distribution patterns with known compartment markers

  • Immunogold Electron Microscopy:

    • Provides high-resolution localization data

    • Requires specific antibodies against the permease or the His tag

  • Protease Protection Assays:

    • Determine membrane topology of the permease

    • Identify cytosolic versus luminal/extracellular domains

These methods should be conducted under various conditions (nutrient availability, stress, cell cycle stages) to capture condition-dependent localization patterns .

How can researchers study the temporal expression patterns of S. pombe amino-acid permease C9.10 during different growth phases?

To study temporal expression patterns of the permease, implement RNA sequencing (RNAseq) analysis across different growth phases following this methodological workflow:

  • Sample Collection:

    • Harvest S. pombe cells at defined timepoints (lag, early exponential, mid-exponential, late exponential, and stationary phases)

    • Extract total RNA using TRIzol or equivalent method

    • Validate RNA quality (RIN > 8.0) before proceeding

  • RNAseq Analysis:

    • Prepare libraries and perform high-throughput sequencing

    • Normalize the data using the DATAnormalization() function from the MultiRNAflow package

    • Perform principal component analysis (PCA) using PCAanalysis() to visualize temporal patterns

    • Apply temporal clustering with MFUZZanalysis() to identify genes with similar expression patterns

  • Gene Expression Profiling:

    • Visualize expression profiles using DATAplotExpressionGenes()

    • Perform differential expression analysis with DEanalysisGlobal()

    • Generate volcano plots and heatmaps with DEplotVolcanoMA() and DEplotHeatmaps()

This approach allows for comprehensive mapping of expression dynamics and identification of co-regulated genes that may function in the same pathway as the amino-acid permease .

What strategies can be employed to resolve structural features of S. pombe amino-acid permease C9.10?

Resolving structural features of membrane proteins like amino-acid permeases requires specialized approaches:

  • Crystallography Preparation:

    • Express protein with fusion partners to enhance solubility

    • Perform extensive detergent screening to identify optimal solubilization conditions

    • Implement limited proteolysis to identify stable domains

    • Use lipidic cubic phase (LCP) crystallization for membrane proteins

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly valuable for membrane proteins resistant to crystallization

    • Prepare homogeneous protein samples in appropriate detergent micelles or nanodiscs

    • Process data using software packages like RELION or cryoSPARC

  • Computational Structure Prediction:

    • Employ AlphaFold2 or RoseTTAFold for initial structure prediction

    • Validate predictions with experimental data from limited proteolysis, crosslinking, or SAXS

  • Structure Validation:

    • Compare predicted structures with experimental data

    • Assess conservation patterns across homologous permeases

    • Validate functionally important residues through site-directed mutagenesis

The structural information obtained can guide further functional studies and provide insights into substrate binding mechanisms and transport kinetics .

How can researchers investigate post-translational modifications of S. pombe amino-acid permease C9.10?

Investigation of post-translational modifications (PTMs) requires a systematic analytical approach:

  • Mass Spectrometry Analysis:

    • Purify the recombinant protein to >95% homogeneity

    • Perform in-gel or in-solution digestion with multiple proteases

    • Analyze using LC-MS/MS with HCD and ETD fragmentation modes

    • Search for specific modifications (phosphorylation, ubiquitination, glycosylation)

  • Site-Directed Mutagenesis:

    • Mutate predicted modification sites (Ser/Thr for phosphorylation, Lys for ubiquitination)

    • Assess functional consequences through transport assays

    • Compare protein stability and localization between wild-type and mutant proteins

  • Time-course Analysis:

    • Monitor modification patterns under different conditions

    • Correlate modifications with functional states of the permease

PTM TypeDetection MethodFunctional Assessment
PhosphorylationPhospho-specific antibodies, MS/MSTransport activity, localization
UbiquitinationAnti-ubiquitin antibodies, MS/MSProtein stability, endocytosis rates
GlycosylationGlycosidase treatment, lectin bindingProtein folding, trafficking

These approaches provide insights into regulatory mechanisms controlling permease activity and localization in response to environmental conditions .

What statistical approaches are recommended for analyzing transport kinetics data for S. pombe amino-acid permease C9.10?

When analyzing transport kinetics data, employ the following statistical framework:

  • Nonlinear Regression Analysis:

    • Fit transport data to appropriate kinetic models (Michaelis-Menten, Hill equation)

    • Use software like GraphPad Prism or R with the 'drc' package

    • Compare different models using Akaike Information Criterion (AIC) or F-test

  • Statistical Hypothesis Testing:

    • Compare kinetic parameters between conditions using appropriate statistical tests

    • For normally distributed data: t-test (two conditions) or ANOVA (multiple conditions)

    • For non-parametric data: Mann-Whitney U test or Kruskal-Wallis test

  • Experimental Design Considerations:

    • Include minimum triplicate measurements for each concentration

    • Implement randomization to minimize systematic errors

    • Include appropriate controls to account for non-specific binding/uptake

  • Validation Approaches:

    • Use bootstrap resampling to validate confidence intervals for kinetic parameters

    • Perform sensitivity analysis to identify influential data points

    • Validate findings across independent experimental replicates

This comprehensive statistical framework ensures robust interpretation of kinetic data while controlling for experimental variability .

How should researchers integrate transcriptomic and proteomic data to understand the regulation of S. pombe amino-acid permease C9.10?

For integrating multi-omics data to understand permease regulation:

  • Data Collection and Normalization:

    • Collect transcriptomic data (RNAseq) and proteomic data (LC-MS/MS) from the same experimental conditions

    • Normalize transcriptomic data using DATAnormalization() from MultiRNAflow

    • Normalize proteomic data using appropriate intensity-based methods

  • Correlation Analysis:

    • Calculate Pearson or Spearman correlation between mRNA and protein levels

    • Identify discordant patterns suggesting post-transcriptional regulation

  • Network Analysis:

    • Construct gene regulatory networks using transcription factor binding data

    • Build protein-protein interaction networks from proteomic data

    • Identify regulatory hubs affecting permease expression and function

  • Pathway Enrichment:

    • Perform Gene Ontology (GO) enrichment analysis using gprofiler2

    • Implement gene set enrichment analysis (GSEA) for pathway-level understanding

    • Generate visualization of enriched pathways for interpretation

  • Time-Course Analysis:

    • Apply temporal clustering with MFUZZanalysis() to identify co-regulated gene clusters

    • Compare protein and transcript dynamics to identify regulatory lag times

This integrated approach provides a systems-level understanding of the regulatory mechanisms controlling permease expression, modification, and function .

What bioinformatic approaches can be used to predict functional domains and regulatory elements in S. pombe amino-acid permease C9.10?

To predict functional domains and regulatory elements, implement this methodological workflow:

  • Sequence Analysis:

    • Perform multiple sequence alignment with homologous permeases

    • Identify conserved residues and motifs using MEME, GLAM2, or similar tools

    • Calculate evolutionary conservation scores using ConSurf or Rate4Site

  • Structural Feature Prediction:

    • Predict transmembrane domains using TMHMM, Phobius, or MEMSAT

    • Identify potential substrate binding pockets using SiteMap or CASTp

    • Analyze electrostatic surface properties to identify potential interaction sites

  • Functional Motif Identification:

    • Search for known transporter motifs using InterProScan or PROSITE

    • Identify potential phosphorylation sites using NetPhos or GPS

    • Predict ubiquitination sites using UbPred or UbiSite

  • Regulatory Element Analysis:

    • Analyze promoter region for transcription factor binding sites using JASPAR

    • Identify potential microRNA binding sites in 3'UTR using TargetScan

    • Predict mRNA stability elements using RegRNA

The integration of these computational approaches guides experimental design by generating testable hypotheses about structure-function relationships in the permease .

What strategies can researchers employ when facing low expression yields of Recombinant S. pombe amino-acid permease C9.10?

When encountering low expression yields, implement this systematic troubleshooting approach:

  • Expression System Optimization:

    • Test multiple E. coli strains (BL21, Rosetta, C41/C43 for membrane proteins)

    • Evaluate different induction conditions (temperature, IPTG concentration, duration)

    • Consider alternative expression hosts (yeast, insect cells) for eukaryotic proteins

  • Construct Modification:

    • Optimize codon usage for the expression host

    • Test different fusion tags (MBP, SUMO, GST) to enhance solubility

    • Express functional domains separately if full-length protein proves challenging

    • Introduce stabilizing mutations based on homology modeling

  • Culture Condition Optimization:

    • Test enriched media formulations (TB, 2XYT) instead of standard LB

    • Implement auto-induction protocols for gentler expression

    • Add specific supplements (amino acids, cofactors) that might enhance folding

  • Harvest and Lysis Optimization:

    • Optimize cell lysis methods (sonication vs. French press vs. detergent)

    • Test different detergents for membrane protein solubilization

    • Include appropriate protease inhibitors and reducing agents

These systematic approaches address the common challenges associated with recombinant expression of eukaryotic membrane proteins in heterologous systems .

How can researchers address potential functional differences between recombinant and native S. pombe amino-acid permease C9.10?

To address potential functional differences between recombinant and native forms:

  • Functional Validation:

    • Compare transport kinetics between native and recombinant protein

    • Assess substrate specificity profiles using radiotracer uptake assays

    • Evaluate pH and temperature optima for both forms

  • Structural Comparison:

    • Analyze post-translational modification patterns

    • Compare oligomerization states using native PAGE or size exclusion chromatography

    • Assess thermal stability using differential scanning fluorimetry

  • Expression System Selection:

    • Consider expressing the protein in S. pombe itself to maintain native folding environment

    • If using E. coli, supplement with specific lipids found in yeast membranes

    • Use yeast-derived membrane mimetics (nanodiscs, liposomes) for functional assays

  • Complementation Testing:

    • Express recombinant protein in S. pombe deletion strains lacking the native permease

    • Assess restoration of phenotypes (growth, amino acid uptake)

    • Compare cellular localization patterns between native and recombinant proteins

This comprehensive validation approach ensures that findings obtained with recombinant proteins accurately reflect the physiological function of the native permease .

What approaches can help resolve experimental inconsistencies in substrate transport assays for S. pombe amino-acid permease C9.10?

When facing experimental inconsistencies in transport assays:

  • Methodological Standardization:

    • Standardize protein quantification methods (BCA, Bradford) for accurate normalization

    • Maintain consistent buffer compositions and pH across experiments

    • Control temperature rigorously during uptake measurements

    • Use internal standards for each experimental batch

  • Technical Validation:

    • Implement technical triplicates for each measurement

    • Include positive controls (known transporters) in each experiment

    • Assess non-specific binding/uptake using denatured protein samples

    • Validate findings across multiple measurement techniques

  • Statistical Approaches:

    • Identify and exclude outliers using robust statistical methods

    • Implement mixed-effects models to account for batch variation

    • Use bootstrapping to generate confidence intervals for kinetic parameters

  • Systematic Error Identification:

    • Test for time-dependent changes in transport activity

    • Evaluate potential inhibitors or activators in buffer components

    • Assess protein stability throughout the duration of transport assays

These approaches help identify and address sources of experimental variability, leading to more reproducible and reliable characterization of permease function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.