Recombinant Schizosaccharomyces pombe Uncharacterized derlin-like protein C1687.17c (SPAC1687.17c)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Schizosaccharomyces pombe Uncharacterized Derlin-Like Protein C1687.17c (SPAC1687.17c)

Recombinant Schizosaccharomyces pombe Uncharacterized Derlin-Like Protein C1687.17c (SPAC1687.17c) is a genetically engineered protein derived from the fission yeast Schizosaccharomyces pombe. This protein is classified as a member of the Der1-like (degradation in the ER) family, which is implicated in endoplasmic reticulum-associated degradation (ERAD) processes . The recombinant form is produced for research applications, including functional studies and protein interaction assays .

Predicted Role in ER-Associated Degradation

SPAC1687.17c shares homology with Der1-like proteins, which are critical for ERAD—a quality-control mechanism that targets misfolded proteins for proteasomal degradation . While its exact substrate specificity remains uncharacterized, structural similarities suggest involvement in substrate recognition or translocation .

Genetic and Proteomic Studies

  • Gene Deletion Phenotype: Deletion of SPAC1687.17c in S. pombe is viable, indicating it is non-essential under standard laboratory conditions .

  • Protein Interaction Network:

    InteractorFunctionInteraction Score
    fhl1Forkhead transcription factor regulating mitosis and septum formation0.607
    hhf1Histone H4 involved in chromatin organization0.540
    sfc6Transcription factor subunit for RNA polymerase III recruitment0.539

Role in Fission Yeast Research

  • Plasmid Construction: SPAC1687.17c studies benefit from S. pombe’s advanced genetic tools, including recombination-based plasmid engineering .

  • Proteomic Profiling: Comparative proteomics in S. pombe has identified secretory pathway limitations, providing context for optimizing recombinant protein yields .

Future Directions

Current gaps include resolving SPAC1687.17c’s precise mechanistic role in ERAD and its interaction partners during stress conditions. Advances in S. pombe proteomics and CRISPR-based editing could accelerate functional characterization .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if available.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag if feasible.
Synonyms
SPAC1687.17c; Uncharacterized derlin-like protein C1687.17c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC1687.17c
Target Protein Sequence
MAILPEFISQTPPVTRYIVLGTLFTTLAVNFGYVSDLKIFFNWKLFLAKGEYWRAITTFL YVGPFGLELILYLSFLLRFMSMLERSSPPPQTQSFLKTVLIVWFSLLVTSYFSYMPFAAS YFSFTMLYIWSWKHPLYRISILGLFDVKAPYVPWVMVLLRWLRTGIFPLLDLISALIGHV YFFVTDFSTV
Uniprot No.

Target Background

Database Links
Protein Families
Derlin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.