Recombinant Schizosaccharomyces pombe Uncharacterized glycosyltransferase C17G8.11c (SPAC17G8.11c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
SPAC17G8.11c; Inositol phosphoceramide mannosyltransferase 3; IPC mannosyltransferase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC17G8.11c
Target Protein Sequence
MNKILFYFFFFLTLILSATVYLFGGPMMLFFINYKTDLLKVDDVYNHEIYSNQSAAIPKI IHQTWKTNEIPEKWVGAQKSCIDLHPDYEYVLWTDESMREFIATDYPWFLTQYDSYPYNI ERADVVRYFILYKYGGIYLDLDVGCNRTLDPLLHYPAWVRRTSPSGISNNVMGFAKGHPF LLQVVRNLPRFAFNYHFPYLTVMYSTGPLFLSIIWSAWRKLPDAEAWHHIWVMVPELYEK SHHAFFEIYEGSSWHDSDAGFVFYMLHHWAIFTFLGFLTFFIVVYFIFGYALKPAARVSR TGRRVFSSPFSKTSPSRWKIFHRFTSSNEKYDQTRSDSLPFMSDYDLESQTQSHSP
Uniprot No.

Target Background

Function

In Schizosaccharomyces pombe, the uncharacterized glycosyltransferase C17G8.11c (SPAC17G8.11c), along with IMT1 and IMT2, is essential for the biosynthesis of mannosylinositol phosphoceramide (MIPC). SPAC17G8.11c catalyzes the addition of mannose to inositol phosphoceramide (IPC). MIPC plays a critical role in various cellular processes, including maintaining cell morphology, regulating the cell-surface distribution of ergosterol, influencing the localization of plasma membrane transporters, and mediating lipid-raft-dependent endocytosis of plasma membrane proteins to the vacuole.

Database Links
Protein Families
Glycosyltransferase 32 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is SPAC17G8.11c and what experimental approaches are recommended for initial characterization?

SPAC17G8.11c is an uncharacterized glycosyltransferase from Schizosaccharomyces pombe (strain 972 / ATCC 24843), commonly known as fission yeast . The protein is catalogued in UniProt under the accession number Q10323 and is classified as an enzyme with EC number 2.4.-.- (indicating incomplete characterization of its specific glycosyltransferase activity) .

For initial characterization, researchers should consider a multi-faceted experimental approach:

  • Expression analysis using RT-PCR and Western blotting to determine natural expression levels

  • Subcellular localization studies using fluorescent tagging

  • Preliminary activity assays with common glycosyl donors and acceptors

  • Phenotypic analysis of knockout/knockdown mutants

The experimental design should include appropriate controls and a randomized block design to account for batch effects and environmental variables, similar to the approach described for other complex biological systems .

What are the optimal storage conditions for SPAC17G8.11c antibodies and recombinant proteins?

Based on manufacturer guidelines, the optimal storage conditions differ between antibodies and recombinant proteins:

For SPAC17G8.11c Antibodies:

  • Upon receipt, store at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles

  • Antibodies are supplied in 50% glycerol, 0.01M PBS, pH 7.4 with 0.03% Proclin 300 as preservative

For Recombinant SPAC17G8.11c:

  • For long-term storage, store at -20°C/-80°C

  • Liquid form shelf life: approximately 6 months at -20°C/-80°C

  • Lyophilized form shelf life: approximately 12 months at -20°C/-80°C

  • For working aliquots, store at 4°C for up to one week

  • After reconstitution, add 5-50% glycerol (final concentration) and aliquot for long-term storage

Experimental evidence indicates that protein stability is significantly impacted by storage conditions. A systematic analysis of stability factors should be incorporated into any experimental design involving this protein to ensure consistent results.

What methodological considerations should be applied when using SPAC17G8.11c antibodies in experimental protocols?

When designing experiments using SPAC17G8.11c antibodies, researchers should consider the following methodological approaches:

ApplicationRecommended DilutionControlsSpecial Considerations
Western Blot1:500-1:2000Positive control: S. pombe lysate
Negative control: Unrelated yeast species
Use PVDF membrane; Include molecular weight marker to verify target band
ELISA1:1000-1:5000Titration series with recombinant proteinPre-adsorb antibody to reduce background
Immunoprecipitation1:50-1:200IgG controlUse protein A/G beads for rabbit polyclonal antibodies

The antibody is polyclonal, raised in rabbit, and purified by antigen affinity chromatography . For all applications, validation of antibody specificity is essential and should be integrated into the experimental design. This includes performing proper blocking steps and conducting preliminary titration experiments to determine optimal concentration for each specific application.

How should recombinant SPAC17G8.11c protein be reconstituted for experimental use?

The proper reconstitution of recombinant SPAC17G8.11c is critical for maintaining its structural integrity and functional activity. Follow this methodological approach:

  • Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (manufacturer recommends 50% as default)

  • Aliquot into small volumes to minimize freeze-thaw cycles

  • Store according to recommended conditions (-20°C/-80°C)

When designing experiments using the reconstituted protein, incorporate controls to verify protein activity is maintained after reconstitution. This should include positive controls with known activity and negative controls to establish baseline measurements.

What experimental design strategies are most effective for elucidating the substrate specificity of SPAC17G8.11c?

To systematically determine substrate specificity of SPAC17G8.11c, researchers should implement a multi-phase experimental design:

Phase 1: Initial Screening

  • Employ a glycan array approach testing multiple potential substrates simultaneously

  • Implement a semi-automated system similar to the Simulator Monitoring and Control (SMAC) system to manage complex experimental variables

  • Design a factorial experiment testing multiple combinations of donor nucleotide-sugars and acceptor molecules

Phase 2: Detailed Kinetic Analysis

  • For hits identified in Phase 1, perform detailed kinetic analyses

  • Determine Km, Vmax, and catalytic efficiency (kcat/Km) for each potential substrate

  • Compare against known glycosyltransferases to establish relative activity profiles

Phase 3: Structural Validation

  • Confirm the addition of specific sugar moieties using mass spectrometry

  • Validate the glycosidic linkage type using NMR spectroscopy

  • Perform isothermal titration calorimetry (ITC) to measure binding affinities

An example experimental matrix for Phase 1 is presented below:

Nucleotide-sugar DonorAcceptor Substrate CategoryNumber of VariantsExperimental ReplicatesControl Type
UDP-glucoseSimple glycans123Known glycosyltransferase
UDP-galactoseComplex glycans83Heat-inactivated enzyme
GDP-mannoseGlycoproteins63No enzyme
CMP-sialic acidGlycolipids43Substrate only

Apply a randomized complete block design with appropriate statistical analysis, including ANOVA for comparing activity across substrate groups and post-hoc testing for identifying significant differences between specific substrates .

How can researchers effectively address challenges in structural characterization of SPAC17G8.11c?

The structural characterization of uncharacterized glycosyltransferases like SPAC17G8.11c presents unique challenges requiring a comprehensive methodological approach:

Challenge 1: Protein Expression and Purification

  • Express in both prokaryotic (E. coli) and eukaryotic (insect cells) systems to compare functionality

  • Implement FPLC purification strategy with sequential columns (affinity, ion exchange, size exclusion)

  • Assess protein homogeneity using dynamic light scattering before crystallization attempts

Challenge 2: Crystallization

  • Screen multiple truncation constructs to identify stable domains

  • Employ surface entropy reduction mutagenesis to enhance crystallization probability

  • Utilize high-throughput crystallization screening (>1000 conditions) with automated monitoring

Challenge 3: Structural Analysis Without Crystals

The experimental design should incorporate proper controls and multiple technical replicates for each condition. Statistical analysis of diffraction quality crystals should be performed to identify significant variables affecting crystallization, using methods similar to those employed in complex research simulator systems .

What are the recommended approaches for analyzing potential functional roles of SPAC17G8.11c in cellular processes?

To systematically investigate the functional roles of SPAC17G8.11c in cellular processes, implement a comprehensive experimental design strategy:

Genetic Approach:

  • Generate knockout/knockdown strains using CRISPR-Cas9 or RNAi

  • Construct overexpression strains with inducible promoters

  • Create temperature-sensitive mutants for conditional studies

  • Design a factorial experiment testing multiple phenotypic parameters

Interactome Analysis:

  • Perform yeast two-hybrid screening to identify protein interaction partners

  • Validate key interactions using co-immunoprecipitation with anti-SPAC17G8.11c antibodies

  • Conduct BioID or APEX proximity labeling to identify proximal proteins

  • Map interaction networks and functional clusters

Metabolic Impact Assessment:

  • Perform metabolomics analysis comparing wild-type and mutant strains

  • Quantify changes in glycan profiles using mass spectrometry

  • Assess alterations in cellular glycosylation patterns

  • Measure impact on cell wall integrity and stress response

The following experimental matrix demonstrates a possible approach for phenotypic analysis:

Strain TypeGrowth ConditionsPhenotypic ParametersAnalytical MethodsReplicates
Wild-typeStandard mediaCell morphologyMicroscopy5
SPAC17G8.11c knockoutOsmotic stressGrowth rateGrowth curves5
SPAC17G8.11c overexpressionTemperature stressCell wall compositionHPLC analysis5
Point mutantsNutrient limitationProtein glycosylationMass spectrometry5

Design your experiments using randomized block designs to control for batch effects, and analyze data using appropriate statistical methods including ANOVA and multivariate analysis .

How can researchers validate the specificity and reliability of anti-SPAC17G8.11c antibodies for advanced applications?

Validating antibody specificity is critical for reliable research outcomes. For SPAC17G8.11c antibodies, implement this systematic validation protocol:

1. Western Blot Validation:

  • Compare signal from wild-type and SPAC17G8.11c knockout S. pombe lysates

  • Test cross-reactivity with lysates from related yeast species

  • Perform peptide competition assay to confirm specific epitope recognition

  • Quantify signal-to-noise ratio across multiple antibody concentrations

2. Immunoprecipitation Quality Control:

  • Implement a sequential validation approach:

    • IP followed by Western blot detection with the same antibody

    • IP followed by detection with an antibody recognizing a different epitope

    • IP followed by mass spectrometry for unbiased identification

    • Reverse-IP using tagged SPAC17G8.11c constructs

3. Immunostaining Specificity Assessment:

  • Compare staining patterns in wild-type vs. knockout cells

  • Conduct co-localization studies with known subcellular markers

  • Perform blocking peptide controls to confirm specificity

  • Quantify signal distribution across multiple cells and experiments

A structured experimental design matrix for antibody validation:

Validation ApproachPositive ControlsNegative ControlsQuantitative MetricsAcceptance Criteria
Western BlotRecombinant SPAC17G8.11cKnockout lysateSignal-to-noise ratio>10:1 ratio
ImmunoprecipitationTagged SPAC17G8.11cIgG control IPEnrichment factor>20-fold enrichment
Mass Spec ValidationSpiked recombinant proteinUnrelated protein mixPeptide coverage>40% coverage
ImmunofluorescenceOverexpression constructSecondary onlyCoefficient of variationCV < 20%

Analyze validation data using appropriate statistical methods to determine confidence intervals for specificity metrics. This rigorous approach ensures reproducible results in downstream applications .

What experimental design considerations are critical when investigating potential post-translational modifications of SPAC17G8.11c?

Investigating post-translational modifications (PTMs) of SPAC17G8.11c requires a carefully designed experimental approach:

1. Comprehensive PTM Screening:

  • Perform initial broad-spectrum PTM analysis:

    • Phosphorylation: Pro-Q Diamond staining and phospho-specific antibodies

    • Glycosylation: Periodic acid-Schiff staining and lectin blotting

    • Ubiquitination: Anti-ubiquitin immunoblotting

    • Other PTMs: Acetylation, methylation, SUMOylation-specific detection

2. Mass Spectrometry Analysis Strategy:

  • Implement a multi-enzyme digestion approach:

    • Trypsin for standard peptide generation

    • Chymotrypsin for complementary coverage

    • Glu-C for regions resistant to trypsin cleavage

  • Apply enrichment techniques for specific PTMs:

    • TiO2 chromatography for phosphopeptides

    • Lectin affinity for glycopeptides

    • Ubiquitin remnant antibodies for ubiquitinated peptides

3. Functional Impact Assessment:

  • Generate PTM site mutants (e.g., S/T→A for phosphorylation sites)

  • Assess activity, localization, and interaction changes

  • Implement time-course studies following cellular perturbations

  • Correlate PTM status with enzymatic activity measurements

A structured experimental design matrix for PTM analysis would include:

ConditionPTM TypeEnrichment MethodDetection TechniqueBiological ReplicatesTechnical Replicates
Standard growthPhosphorylationTiO2 enrichmentLC-MS/MS32
Osmotic stressPhosphorylationTiO2 enrichmentLC-MS/MS32
Standard growthGlycosylationLectin affinityLC-MS/MS32
Oxidative stressUbiquitinationK-ε-GG antibodyLC-MS/MS32

Statistical analysis should include appropriate normalization methods, significance testing for differential modification, and correlation analysis between different PTMs and functional outcomes. This experimental design allows for systematic characterization of PTMs and their functional significance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.