Recombinant Schizosaccharomyces pombe Uncharacterized J domain-containing protein C17A3.05c (pi041, SPBC17A3.05c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
pi041; SPBC17A3.05c; Uncharacterized J domain-containing protein C17A3.05c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
pi041
Target Protein Sequence
MESSREEALRCIGLARKYLNAGEYDKALKFANKSLRIHATTEGEDFVKQIEKQKLTGSPN PQATPKQENKSNFFSEKQSVRENGNSSAGEKKQKWTSEQHLLVQKIIKYKNHQYYEILDL KKTCTDTEIKKSYKKLALQLHPDKNHAPSADEAFKMVSKAFQVLSDPNLRAHYDRTGMDP ESRASAASSSFSSNAGGHPGFSAYPQANMSPEDLFNSFFGDQFFSGPGTFFFGGGPGIRV HQFGGRPRNFARRQQAQDMPPKSIFYQLLPLIVVILFAFLSNFSWSDSTSVNTRYSFQQN YKYTVPRTTAKHNIPYYMSQKDLDKLSSRDIRRLNEKVEHTYTQNVHNACLREQQIKEDE IRRAQGWFFPDKEALKKAKELRLPNCEELNRLGYRTYSNSYYF
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant pi041 protein?

The recombinant pi041 protein can be successfully expressed in E. coli expression systems with an N-terminal His-tag. The protein has been produced as a full-length recombinant protein (1-403 amino acids) in E. coli . When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli

  • Addition of appropriate affinity tags (His-tag has been demonstrated to work effectively)

  • Selection of a suitable vector with strong promoters

  • Optimization of induction conditions for maximum protein yield

For eukaryotic post-translational modifications, yeast or mammalian expression systems might be more appropriate, although empirical validation would be required .

How should recombinant pi041 protein be stored for optimal stability?

The recombinant pi041 protein typically comes as a lyophilized powder. For optimal stability, researchers should follow these storage guidelines:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, store at 4°C for up to one week for working solutions

  • For long-term storage, add 5-50% glycerol (final concentration) and store in aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this can reduce protein activity and integrity

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

The default final concentration of glycerol typically used is 50%. Properly stored, the protein maintains greater than 90% purity as determined by SDS-PAGE .

What functional roles might the J domain in pi041 play in Schizosaccharomyces pombe cellular processes?

J domains are typically found in proteins that interact with Hsp70 chaperones to regulate their ATPase activity. While pi041 remains uncharacterized, the presence of a J domain suggests potential roles in:

  • Protein quality control and folding pathways

  • Stress response mechanisms

  • Cellular protein trafficking

  • Regulation of protein-protein interactions

  • Cell cycle regulation (particularly relevant in yeast systems)

Research methodologies to investigate these functions would include:

  • Yeast two-hybrid screening to identify protein-protein interactions

  • Co-immunoprecipitation studies with potential binding partners

  • Gene knockout/knockdown studies followed by phenotypic characterization

  • Proteomic profiling under various stress conditions

  • Localization studies using GFP-fusion proteins or immunofluorescence

The evolutionary conservation of J domain proteins across species suggests fundamental cellular functions, though specific roles may vary between organisms.

How does the structure of pi041 compare to other characterized J domain-containing proteins?

While the complete structure of pi041 has not been fully determined, comparative structural analysis with other J domain-containing proteins would involve:

  • Sequence alignment with characterized J domain proteins

  • Homology modeling based on existing crystal structures

  • Secondary structure prediction using computational tools

  • Domain architecture analysis

Typical J domains contain four helices with a highly conserved HPD motif between helices II and III that is critical for stimulating Hsp70 ATPase activity. Analysis of the pi041 sequence should focus on identifying this motif and other conserved features to predict functional capabilities.

The methodological approach should include:

  • Multiple sequence alignment using tools like CLUSTAL or MUSCLE

  • Structural prediction using tools like I-TASSER or Phyre2

  • Validation of predictions using circular dichroism spectroscopy

  • X-ray crystallography or NMR for definitive structural determination

What are the implications of pi041 being uncharacterized in the context of evolutionary proteomics?

The uncharacterized nature of pi041 presents unique opportunities in evolutionary proteomics:

  • Comparative genomic analysis across fungal species can reveal conservation patterns

  • Identification of orthologous proteins in other species can provide functional insights

  • Analysis of selective pressure on the gene may indicate its biological importance

  • Domain architecture comparison across species can reveal evolutionary adaptations

Schizosaccharomyces pombe is evolutionarily distant from Saccharomyces cerevisiae and in many aspects more closely related to metazoans in its genetic organization. This evolutionary position makes pi041 particularly interesting for understanding protein evolution between fungi and higher eukaryotes .

Methods to explore this include:

  • Phylogenetic analysis using maximum likelihood or Bayesian approaches

  • Calculation of dN/dS ratios to assess selective pressure

  • Synteny analysis to examine genomic context conservation

  • Ancestral sequence reconstruction to trace evolutionary changes

What purification strategies are most effective for recombinant pi041 protein?

The recombinant pi041 protein with an N-terminal His-tag can be purified using the following optimized protocol:

  • Affinity chromatography using nickel or cobalt resin (exploiting the His-tag)

  • Buffer optimization (typically Tris/PBS-based buffer, pH 8.0)

  • Followed by size exclusion chromatography to remove aggregates and improve homogeneity

  • Optional ion exchange chromatography for higher purity

A typical purification workflow would include:

StepMethodBufferExpected Results
1Cell lysisLysis buffer with protease inhibitorsCell-free extract
2ClarificationCentrifugationClear lysate
3IMACHis-tag binding buffer>80% purity
4Size exclusionTris/PBS pH 8.0>90% purity
5ConcentrationUltrafiltrationFinal product

The final product should be assessed by SDS-PAGE for purity (>90%) and Western blot for identity confirmation using anti-His antibodies or specific antibodies against pi041 if available .

What expression optimization strategies can maximize the yield of functional pi041 protein?

To maximize the yield of functional recombinant pi041 protein, consider these optimization strategies:

  • Strain selection: BL21(DE3), Rosetta, or Arctic Express for proteins with rare codons

  • Temperature optimization: Lower temperatures (16-25°C) often improve folding

  • Induction parameters: IPTG concentration and induction timing

  • Co-expression with chaperones: May improve folding of J domain proteins

  • Media optimization: Rich media (TB, 2YT) vs. minimal media

A systematic optimization approach would include:

ParameterVariables to TestMeasurement
Temperature16°C, 25°C, 37°CYield, solubility
IPTG concentration0.1mM, 0.5mM, 1.0mMInduction efficiency
Induction timeOD600 0.4, 0.6, 0.8Growth phase effect
Induction duration4h, 8h, overnightAccumulation vs. degradation
MediaLB, TB, 2YT, M9Nutrient effect

For complex proteins like pi041, testing fusion partners (MBP, SUMO, GST) may improve solubility. The expression should be monitored by SDS-PAGE and Western blotting, with activity assays designed to confirm functionality .

How can researchers effectively reconstitute lyophilized pi041 protein while maintaining activity?

Effective reconstitution of lyophilized pi041 protein requires careful attention to buffer conditions and handling:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Allow complete dissolution by gentle mixing (avoid vortexing)

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • Prepare small aliquots to avoid freeze-thaw cycles

Critical parameters to monitor during reconstitution:

ParameterRecommendationRationale
pHMaintain at 8.0Optimal for stability
TemperatureReconstitute at room temperature, then transfer to 4°CPrevents denaturation
Protein concentration0.1-1.0 mg/mLPrevents aggregation
Storage bufferTris/PBS with 6% TrehaloseEnhances stability
Aliquot sizeSufficient for single experimentMinimizes freeze-thaw cycles

After reconstitution, verify protein integrity by SDS-PAGE and assess activity using appropriate functional assays specific to J domain proteins, such as ATPase stimulation assays if pi041 is confirmed to interact with Hsp70 proteins .

How should researchers approach functional characterization of uncharacterized proteins like pi041?

The functional characterization of uncharacterized proteins like pi041 requires a multi-faceted approach:

  • Bioinformatic prediction:

    • Sequence homology with characterized proteins

    • Domain prediction and analysis

    • Structural modeling and prediction

    • Genomic context analysis

  • Expression analysis:

    • Transcriptome profiling under various conditions

    • Proteome analysis to identify expression patterns

    • Co-expression network analysis

  • Functional genomics:

    • Gene deletion/knockout phenotyping

    • Overexpression studies

    • Genetic interaction mapping

  • Biochemical characterization:

    • Protein-protein interaction studies

    • Subcellular localization

    • Post-translational modification analysis

    • In vitro activity assays

For J domain-containing proteins specifically, researchers should investigate the interaction with Hsp70 chaperones as a priority, since this is the canonical function of J domains. The methodological approach should progress from computational predictions to in vitro validations to in vivo confirmations .

What analytical methods are most appropriate for studying protein-protein interactions involving pi041?

To investigate protein-protein interactions involving pi041, researchers should employ multiple complementary approaches:

  • In vitro methods:

    • Pull-down assays using recombinant His-tagged pi041

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Analytical ultracentrifugation for complex formation

  • In vivo methods:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation from S. pombe lysates

    • Proximity labeling (BioID, APEX)

    • Fluorescence resonance energy transfer (FRET)

  • Structural methods:

    • X-ray crystallography of protein complexes

    • Cryo-electron microscopy for larger assemblies

    • NMR spectroscopy for dynamic interactions

Data analysis should integrate results from multiple methods to build confidence in identified interactions:

MethodStrengthsLimitationsData Analysis Approach
Pull-downDirect physical interactionPotential for non-specific bindingMass spectrometry identification with statistical filtering
Y2HIn vivo contextFalse positives/negativesMultiple bait constructs, stringent selection
Co-IPPhysiological conditionsRequires antibodiesWestern blot validation, controls for specificity
FRETReal-time dynamicsTechnical complexityCareful controls, statistical analysis

For J domain proteins like pi041, specific attention should be paid to interactions with the Hsp70 family of chaperones and co-chaperones .

How can researchers interpret evolutionary conservation patterns of pi041 across fungal species?

Interpreting evolutionary conservation patterns of pi041 across fungal species requires sophisticated phylogenetic analysis:

  • Sequence conservation analysis:

    • Multiple sequence alignment of orthologs

    • Calculation of conservation scores per residue

    • Identification of absolutely conserved motifs

  • Phylogenetic inference:

    • Maximum likelihood or Bayesian tree construction

    • Reconciliation with species phylogeny

    • Estimation of divergence times

  • Selective pressure analysis:

    • Calculation of dN/dS ratios

    • Site-specific selection analysis

    • Lineage-specific selection patterns

  • Structure-function correlation:

    • Mapping conservation onto structural models

    • Identifying functionally critical regions

    • Predicting functional divergence

For pi041, special attention should be paid to the conservation of the J domain, particularly the HPD motif that is critical for function. Given that S. pombe is evolutionarily closer to metazoans than to S. cerevisiae in many aspects, comparison with both fungal and metazoan J domain proteins could provide valuable insights .

A comprehensive analysis might reveal:

  • Core conserved residues essential for J domain function

  • Lineage-specific adaptations suggesting specialized functions

  • Co-evolution patterns with interacting partners

  • Potential neofunctionalization or subfunctionalization events during evolution

How might pi041 be used as a tool in broader proteomic research?

The recombinant pi041 protein can serve as a valuable tool in broader proteomic research through multiple applications:

  • As a model for studying J domain function:

    • Template for structure-function analysis

    • System for examining chaperone networks

    • Model for protein folding studies

  • As a reagent for interaction studies:

    • Bait protein for pull-down assays

    • Target for antibody development

    • Control in chaperone activity assays

  • In comparative proteomics:

    • Reference protein for evolutionary studies

    • Benchmark for post-translational modification analysis

    • Control for recombinant protein expression systems

The utility of pi041 extends beyond its specific function to serve as a model system for studying fundamental aspects of protein biology and biochemistry .

What considerations should researchers make when designing experiments to elucidate the role of pi041 in cellular stress responses?

When investigating pi041's potential role in cellular stress responses, researchers should consider:

  • Stress condition selection:

    • Heat shock (canonical for J proteins)

    • Oxidative stress

    • Nutrient deprivation

    • ER stress

    • Chemical stressors

  • Experimental design elements:

    • Time-course analysis to capture dynamic responses

    • Dose-response studies for quantitative assessment

    • Both acute and chronic stress models

    • Recovery phase analysis

  • Readout selection:

    • Transcriptional response of pi041

    • Protein abundance changes

    • Post-translational modifications

    • Subcellular localization shifts

    • Interactome alterations

  • Genetic manipulation approaches:

    • Knockout/knockdown of pi041

    • Overexpression studies

    • Domain mutation analysis

    • Complementation with homologous proteins

A comprehensive experimental design might include:

Stress TypeConditionsPrimary MeasurementsSecondary Analyses
Heat shock25°C→42°C, various durationspi041 expression levelsLocalization, PTMs
OxidativeH₂O₂ treatment (0.5-5mM)Cell viability in WT vs. knockoutProtein oxidation status
NutrientGlucose depletionpi041 interaction partnersMetabolic pathway impact
ER stressTunicamycin treatmentUPR activationpi041 trafficking

Controls should include known J-domain proteins with established stress response roles for comparative analysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.