Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C1020.11c (SPCC1020.11c)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characterization

SPCC1020.11c is a protein-coding gene in Schizosaccharomyces pombe (fission yeast) with the UniProt ID O59764. It is annotated as a subunit of the ER membrane protein complex (EMC), specifically EMC6, which plays a critical role in membrane fluidity homeostasis and the biogenesis of membrane proteins . The EMC complex assists in the proper folding and localization of sterol transport proteins like Lam6/Ltc1, ensuring optimal ergosterol distribution and mitochondrial function .

Key Molecular Features:

PropertyDetail
Gene NameSPCC1020.11c (EMC6 homolog)
Protein NameUncharacterized membrane protein C1020.11c
OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Amino Acid SequenceMERDKGVAPIVVENVAYNEQVVSFVRNLTSSFFGCAAGILGLTSYEGLALYVLGYFFVSFLLFALKMRGNLTKYYQPGYKFWIAKILDGAPSYVLTWTLFYSLVYVYE
Expression Region1–108 amino acids (full-length protein)
Post-Translational TagsDetermined during production (commonly His-tag or GST-tag)

Research Insights and Functional Role

Recent studies highlight SPCC1020.11c’s role in the EMC complex, which regulates ergosterol homeostasis and membrane fluidity . Key findings include:

  • EMC Deficiency Effects: Loss of EMC function causes mitochondrial aggregation, reduced mtDNA, and cold-sensitive growth due to rigid membranes .

  • Rescue Mechanisms: Membrane fluidization (e.g., using Tween 20) restores mitochondrial morphology and growth in EMC-deficient cells .

  • Interaction Network: SPCC1020.11c colocalizes with other EMC subunits (Emc3, Emc5) at the ER, forming a core structural unit critical for complex assembly .

Applications in Research

Recombinant SPCC1020.11c is utilized to:

  1. Study ER-membrane protein biogenesis and chaperone mechanisms.

  2. Investigate mitochondrial dysfunction linked to membrane fluidity defects .

  3. Develop models for human diseases associated with EMC orthologs (e.g., neurodegenerative disorders) .

Vendor Comparison:

VendorProduct CodeExpression SystemPrice Range*
CusabioCSB-MP528877SXV1Mammalian cellsInquire for quote
GenScriptOSc99041E. coliCustomizable

*Pricing details require direct inquiry.

Future Directions

While SPCC1020.11c remains annotated as "uncharacterized," its association with the EMC complex underscores its importance in lipid homeostasis and membrane biology. Ongoing research aims to:

  • Elucidate its structural role within the EMC.

  • Identify interactors using proteomic approaches .

  • Explore therapeutic targets for diseases linked to ER-mitochondria communication.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on your purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please let us know. We will prioritize developing the specified tag whenever possible.
Synonyms
SPCC1020.11c; ER membrane protein complex subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC1020.11c
Target Protein Sequence
MERDKGVAPIVVENVAYNEQVVSFVRNLTSSFFGCAAGILGLTSYEGLALYVLGYFFVSF LLFALKMRGNLTKYYQPGYKFWIAKILDGAPSYVLTWTLFYSLVYVYE
Uniprot No.

Target Background

Database Links
Protein Families
EMC6 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What are the basic molecular characteristics of SPCC1020.11c?

SPCC1020.11c is a small membrane protein with the following properties:

  • Gene ID: 01/E12

  • ORF length (unspliced): 309 bp

  • No introns: 0

  • Amino acid length: 102 residues

  • Molecular weight: 11.6 kDa

  • Isoelectric point (calculated): 10.0

  • Signal sequence: Predicted at N-terminus

  • Transmembrane domains: 3

This basic profile indicates SPCC1020.11c is a small basic protein with multiple membrane-spanning regions, suggesting potential roles in membrane transport or signaling.

Where is SPCC1020.11c localized within S. pombe cells?

According to YFP-tagged localization studies, SPCC1020.11c is primarily localized to the endoplasmic reticulum (ER) . This ER localization suggests potential roles in:

  • Protein folding or quality control

  • Lipid metabolism

  • Calcium homeostasis

  • ER-associated degradation pathways

Researchers should consider these potential functions when designing experiments to characterize this protein.

How does SPCC1020.11c compare structurally to characterized membrane proteins in other organisms?

While SPCC1020.11c remains uncharacterized, comparative analysis can provide insights:

  • Sequence-based approaches:

    • Perform BLAST searches against characterized proteins

    • Use tools like HCOP (HGNC Comparison of Orthology Predictions) to identify potential orthologs

    • Apply secondary structure prediction algorithms to compare with known membrane protein families

  • Structure prediction methods:

    • Apply modern deep learning approaches like AlphaFold to predict 3D structure

    • Compare predicted structural features with characterized membrane proteins of similar topology

A thorough comparative analysis should examine both sequence homology and predicted structural features to generate testable hypotheses about function.

What expression systems are optimal for recombinant SPCC1020.11c production?

Multiple expression systems can be considered based on research objectives:

Expression SystemAdvantagesDisadvantagesBest For
E. coli- Rapid growth
- High yields
- Inexpensive
- May misfold membrane proteins
- Lacks eukaryotic PTMs
Initial structural studies
Yeast (S. cerevisiae)- Native-like environment
- Eukaryotic PTMs
- Good for membrane proteins
- Lower yields than E. coli
- Longer expression time
Functional studies requiring proper folding
Insect cells- Advanced eukaryotic PTMs
- Good for complex proteins
- Higher cost
- Technical expertise required
Studies requiring complex PTMs
Mammalian cells- Most authentic PTMs
- Native-like membrane environment
- Highest cost
- Lowest yields
- Most technically demanding
Interaction studies with mammalian partners

For SPCC1020.11c specifically, a yeast expression system may provide the best balance of authenticity and yield since it provides a native-like membrane environment while being relatively cost-effective .

What fusion tags are recommended for purification and detection of recombinant SPCC1020.11c?

Selection of appropriate fusion tags depends on experimental goals:

Tag TypeSizeBenefitsLimitationsRecommended Use
His-Tag6-10 aa- Small size
- Metal affinity purification
- Compatible with denaturing conditions
- May be buried in membrane proteins
- Potential for non-specific binding
N-terminal tagging to preserve TM topology
FLAG Tag8 aa- High specificity
- Gentle elution conditions
- Lower binding capacity
- More expensive resins
Western blotting and co-IP studies
MBP42.5 kDa- Enhances solubility
- One-step purification
- Large size affects structure
- May interfere with function
Expression optimization studies
GFP27 kDa- Direct visualization
- Folding indicator
- Large size
- May affect trafficking
Localization studies confirming ER targeting

For SPCC1020.11c, considering its small size (102 aa), a dual-tagging approach with a small N-terminal His-tag for purification and C-terminal FLAG for detection might balance functionality and experimental utility .

What approaches should be used to determine the function of SPCC1020.11c?

A comprehensive approach to functional characterization would include:

  • Genetic approaches:

    • Generate knockout/knockdown strains using CRISPR-Cas9

    • Perform phenotypic analyses under various stress conditions

    • Conduct synthetic lethality screening with other ER proteins

  • Biochemical approaches:

    • Identify interacting partners using proximity labeling techniques (BioID, APEX)

    • Perform lipidomic analysis to detect alterations in membrane lipid composition

    • Investigate potential enzymatic activities through in vitro assays

  • Cell biological approaches:

    • Examine effects on ER morphology and function

    • Monitor calcium homeostasis and ER stress responses

    • Investigate protein trafficking through the secretory pathway

Each approach provides complementary information, and integration of multiple datasets is crucial for robust functional characterization.

How can researchers design experiments to investigate SPCC1020.11c's role in the ER membrane?

Since SPCC1020.11c localizes to the ER , targeted experimental designs should include:

  • ER stress response analysis:

    • Treat cells with ER stressors (tunicamycin, DTT, thapsigargin)

    • Monitor UPR activation in wild-type vs. SPCC1020.11c mutants

    • Measure ER-associated degradation efficiency

  • Membrane integrity and lipid composition:

    • Analyze lipid composition in isolated ER fractions

    • Examine membrane fluidity using fluorescence anisotropy

    • Test integrity of the ER membrane under various stress conditions

  • Protein-protein interactions:

    • Implement split-GFP complementation with known ER proteins

    • Perform co-immunoprecipitation with tagged SPCC1020.11c

    • Use cross-linking mass spectrometry to identify proximal proteins

These approaches directly address SPCC1020.11c's potential functions within its native ER context.

How can SPCC1020.11c be studied in the context of S. pombe cell cycle regulation?

Given S. pombe's importance as a model for cell cycle studies, researchers should consider:

  • Cell cycle-dependent expression analysis:

    • Monitor SPCC1020.11c levels throughout synchronized cell cycles

    • Determine if expression correlates with specific cell cycle phases

    • Investigate potential regulation by cell cycle-dependent kinases

  • Genetic interaction with cell cycle regulators:

    • Test for genetic interactions with key regulators like Cdc25, Cdc2, and Wee1

    • Examine phenotypes in combination with temperature-sensitive cell cycle mutants

    • Investigate potential roles in checkpoint regulation similar to other ER-resident proteins

  • ER-nucleus communication:

    • Investigate potential roles in signaling between ER and nucleus during cell cycle

    • Examine localization during mitosis when ER undergoes significant remodeling

S. pombe's well-characterized cell cycle machinery provides an excellent context for understanding SPCC1020.11c function in relation to cell division regulation .

What approaches can identify potential orthologs of SPCC1020.11c in other organisms?

Identifying orthologs requires sophisticated comparative genomics:

  • Sequence-based methods:

    • Reciprocal BLAST searches against model organism databases

    • Hidden Markov Model (HMM) profile searches for remote homologs

    • Use specialized tools like HCOP that integrate multiple orthology prediction algorithms

  • Structure-based approaches:

    • Compare predicted transmembrane topologies

    • Use threading algorithms to identify proteins with similar predicted folds

    • Search for proteins with similar domain organizations

  • Synteny analysis:

    • Examine conservation of genomic context around SPCC1020.11c

    • Identify conserved gene neighborhoods across fungal species

    • Use tools like SynFind or MCScanX for automated synteny detection

Combining these approaches increases confidence in ortholog identification, especially for divergent membrane proteins where sequence conservation may be limited.

What are the common challenges in expressing and purifying recombinant SPCC1020.11c?

As a small membrane protein with three transmembrane domains, SPCC1020.11c presents specific challenges:

  • Expression obstacles:

    • Protein misfolding and aggregation in non-native membranes

    • Toxicity to host cells if overexpressed

    • Proteolytic degradation due to improper membrane insertion

  • Purification challenges:

    • Detergent selection for efficient solubilization without denaturation

    • Low yields due to limited membrane protein expression

    • Maintaining stability during purification steps

  • Recommended solutions:

    • Test multiple detergents (DDM, LDAO, LMNG) for optimal solubilization

    • Use fusion partners like MBP to enhance folding and stability

    • Consider nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like environment

    • Implement mild solubilization conditions and rapid purification protocols

Each membrane protein requires empirical optimization of expression and purification conditions .

How can researchers validate that recombinant SPCC1020.11c retains its native conformation?

Validating native conformation is critical for functional studies:

  • Structural validation methods:

    • Circular dichroism spectroscopy to assess secondary structure content

    • Limited proteolysis to probe folding and accessibility

    • Thermal stability assays to compare wild-type and recombinant protein

  • Functional validation approaches:

    • Reconstitution into liposomes to test membrane integration

    • Binding assays with known ligands or interacting partners

    • In vitro activity assays based on predicted function

  • Cell-based validation:

    • Complementation of knockout phenotypes with recombinant protein

    • Subcellular localization matching native protein distribution

    • Protein-protein interaction profile comparison with endogenous protein

A combination of these approaches provides confidence that recombinant SPCC1020.11c maintains its physiologically relevant conformation.

How might SPCC1020.11c function be related to mating-type switching in S. pombe?

S. pombe is a model organism for studying mating-type switching, a complex process involving programmed gene conversion events . Although direct evidence linking SPCC1020.11c to this process is lacking, potential connections could be investigated:

  • Expression analysis:

    • Compare SPCC1020.11c expression levels between different mating types

    • Monitor expression during mating and sporulation

    • Examine regulation by mating-type specific transcription factors

  • Functional investigations:

    • Test if SPCC1020.11c deletion affects conjugation efficiency

    • Examine potential roles in pheromone sensing or response

    • Investigate genetic interactions with known mating-type regulators

  • ER-related mating functions:

    • Investigate potential roles in pheromone processing or secretion

    • Examine involvement in cell wall remodeling during conjugation

    • Test for functions in nuclear envelope dynamics during mating

The well-characterized mating pathway in S. pombe provides an excellent experimental system for investigating potential roles of uncharacterized proteins like SPCC1020.11c.

What cutting-edge techniques could accelerate functional characterization of SPCC1020.11c?

Several emerging technologies could significantly advance understanding of SPCC1020.11c:

  • Advanced imaging approaches:

    • Super-resolution microscopy to precisely localize within ER subdomains

    • Live-cell single-molecule tracking to monitor dynamics and interactions

    • Correlative light and electron microscopy for ultrastructural context

  • Proteomics innovations:

    • Proximity labeling (BioID, TurboID) to identify interaction networks

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

    • Cross-linking mass spectrometry to map interaction interfaces

  • Functional genomics:

    • CRISPRi/CRISPRa for titrated expression modulation

    • Perturb-seq for high-throughput phenotypic profiling

    • Synthetic genetic array analysis for comprehensive genetic interaction mapping

  • Structural biology:

    • Cryo-EM for membrane protein structure determination

    • Integrative structural modeling combining multiple experimental data types

    • In-cell NMR for structural analysis in native environments

Integration of these cutting-edge approaches would provide unprecedented insights into SPCC1020.11c function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.