Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C17A2.10c (SPAC17A2.10c)

Shipped with Ice Packs
In Stock

Description

Overview of SPAC17A2.10c

SPAC17A2.10c is an uncharacterized membrane protein encoded by the SPAC17A2 gene in Schizosaccharomyces pombe (fission yeast). It is part of the reference proteome and is annotated as a transmembrane protein localized to the nuclear envelope and nuclear membrane . The protein has a sequence length of 230 amino acids and is conserved in fission yeast species, though its precise biological function remains unknown .

PropertyDetails
UniProt Accession CodeO13760
Gene NameSPAC17A2
OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843)
Subcellular LocalizationNuclear envelope (SL-0178) and nuclear membrane (SL-0182)
Membrane TopologyPredicted transmembrane domains via sequence analysis
Sequence Length230 amino acids

Recombinant Production and Characteristics

Recombinant SPAC17A2.10c has been synthesized for research applications, with variants produced in E. coli, yeast, baculovirus, and mammalian cell systems . Key features include:

  • Expression Systems:

    • E. coli: Product code CSB-EP521036SXV1 (partial sequence, residues 17–230) .

    • Yeast: Product code CSB-YP521036SXV1 .

    • Baculovirus and mammalian systems: Codes CSB-BP521036SXV1 and CSB-MP521036SXV1, respectively .

  • Purity: >85% (SDS-PAGE) .

  • Storage: Lyophilized form stable for 12 months at -20°C/-80°C; liquid form stable for 6 months .

  • Reconstitution: Requires Tris-based buffer with 50% glycerol to maintain stability .

Table: Recombinant Variants and Properties

Expression HostProduct CodeTagSequence CoverageKey Applications
E. coliCSB-EP521036SXV1UndeterminedPartial (17–230)ELISA, functional studies
YeastCSB-YP521036SXV1UndeterminedPartialStructural analysis
BaculovirusCSB-BP521036SXV1UndeterminedPartialProtein interaction assays

Research Findings and Functional Insights

While SPAC17A2.10c remains uncharacterized, transcriptomic studies reveal its involvement in stress response pathways:

  • Sodium Fluoride Stress Response: SPAC17A2.10c expression increases by 4.38-fold in S. pombe exposed to sodium fluoride, suggesting a role in oxidative or ionic stress adaptation .

  • Co-Expressed Genes: Upregulated alongside hexose transporters (Ght1, Ght5) and transcription factors (Cbf12), implicating potential roles in nutrient transport or transcriptional regulation .

  • Conservation: Limited to fission yeast, indicating species-specific functionality .

Implications for Future Research

The protein’s localization to the nuclear envelope and stress-responsive expression pattern warrant further investigation into:

  • Mechanistic Role: Interactions with nuclear pore complexes or membrane transporters.

  • Post-Translational Modifications: Phosphorylation or methylation sites inferred from sequence analysis .

  • Disease Relevance: Homology screening for human nuclear membrane-associated pathologies.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its incorporation.
Synonyms
SPAC17A2.10c; Uncharacterized membrane protein C17A2.10c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-230
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC17A2.10c
Target Protein Sequence
NKITEADKSLVDLLIPSLCCSLAVFPSIPLINTHSNLCLFSNFSHSCFLFCTHPDTLPTS LSINPKKLSLSFSFPLSQKRPFPNFLHPFTGSELSLFRCLLLFFFFLLFFLSFSFSFSFL FFLSQIFIVYFSSFPILHFLFFFFLCVCVFLSFLFSLSHLLSLAILFLPLLLRVFSTLSR LPRLFCLCLQKKRRVLIPFAFTSFRKIASLPCVC
Uniprot No.

Target Background

Database Links
Subcellular Location
Cytoplasm. Nucleus membrane; Multi-pass membrane protein.

Q&A

What are the known structural characteristics of SPAC17A2.10c in Schizosaccharomyces pombe?

SPAC17A2.10c is classified as an uncharacterized membrane protein in S. pombe. While its complete structure remains undetermined, it shares characteristic features with other membrane proteins in this organism. Membrane proteins in S. pombe are known to participate in plasma membrane compartmentalization and are often involved in signaling pathways. Based on research with other membrane proteins, SPAC17A2.10c likely contains transmembrane domains that anchor it to the cell membrane, potentially organizing into functional nanodomains as observed with REMORINs and other membrane-associated proteins .

To determine its structure, researchers typically employ techniques such as recombinant expression followed by purification and structural analysis. The expression system must be carefully selected to ensure proper folding and post-translational modifications of membrane proteins.

What are the optimal conditions for expressing recombinant SPAC17A2.10c in laboratory settings?

Successful expression of recombinant SPAC17A2.10c requires careful optimization of culture conditions. For S. pombe proteins, consider the following protocol:

  • Start with strain selection: Use protease-deficient strains to minimize protein degradation

  • Culture in standard YE media at 28°C until reaching cell density of 2.5×10^6 cells/ml

  • For synchronized cultures, implement the ATP-analogue sensitive allele (cdc2asM17) method with 3-BrB-PP1

  • Harvest cells via vacuum filtration using 0.22 μm filters

  • Extract membrane proteins using specialized buffers containing detergents compatible with membrane protein solubilization

Expression levels should be monitored at different time points post-induction, typically via Western blotting with appropriate antibodies or by incorporating epitope tags if antibodies against the native protein are unavailable.

How can researchers verify the subcellular localization of SPAC17A2.10c in S. pombe cells?

Determining the precise subcellular localization of SPAC17A2.10c requires a multi-method approach:

  • Fluorescent protein tagging: Generate constructs with GFP or other fluorescent protein tags fused to SPAC17A2.10c, preferably at both N- and C-termini to determine which fusion preserves functionality.

  • Confocal microscopy: Visualize live cells expressing the tagged protein to determine general localization patterns.

  • Super-resolution microscopy: For detailed analysis of membrane distribution and potential nanodomain organization, techniques such as PALM or STORM microscopy provide resolution below the diffraction limit .

  • Co-localization studies: Perform dual-labeling experiments with known markers of different cellular compartments to confirm precise localization.

  • Subcellular fractionation: Biochemically separate cellular components and analyze protein distribution using Western blotting as a complementary approach to microscopy.

Remember that tagging may affect protein function, so functional assays should be performed to ensure the tagged protein retains its native activities.

What strategies should be employed to study protein-protein interactions involving SPAC17A2.10c in its native membrane environment?

Investigating protein-protein interactions of membrane proteins like SPAC17A2.10c requires specialized approaches that preserve the membrane environment:

Table 1: Methods for studying membrane protein interactions in S. pombe

MethodAdvantagesLimitationsSample preparation
Proximity labeling (BioID)Identifies transient interactions in native environmentMay capture proximal but non-interacting proteinsExpress BioID-SPAC17A2.10c fusion in S. pombe cells, add biotin, identify biotinylated proteins via mass spectrometry
FRET/BRETMonitors interactions in living cellsRequires fluorescent/luminescent tagging that may affect functionGenerate donor/acceptor tagged proteins, measure energy transfer in vivo
Co-immunoprecipitationCan isolate intact complexesRequires mild detergents that may disrupt some interactionsSolubilize membranes with digitonin or other mild detergents, precipitate with antibodies or affinity tags
Split-ubiquitin systemSpecifically designed for membrane protein interactionsMay generate false positivesTransform cells with bait/prey constructs, measure reporter gene activation
Crosslinking mass spectrometryCaptures direct interaction interfacesComplex data analysisTreat cells with crosslinkers, digest proteins, identify crosslinked peptides

When designing these experiments, it's critical to include appropriate controls, such as known interacting partners and negative controls that should not interact with your protein of interest. Additionally, interactions should be validated using at least two independent methods .

How can researchers assess the functional significance of SPAC17A2.10c in DNA replication and repair mechanisms?

Given that many S. pombe membrane proteins are involved in signaling pathways related to DNA replication and repair, investigating SPAC17A2.10c's potential role in these processes requires systematic approaches:

  • Generate knockout/knockdown strains using CRISPR-Cas9 or traditional homologous recombination techniques to create SPAC17A2.10c-deficient cells.

  • Subject these strains to DNA damage agents (UV, ionizing radiation, hydroxyurea) and assess survival rates compared to wild-type cells.

  • Analyze cell cycle progression in response to replication stress:

    • Monitor cell cycle arrest using flow cytometry

    • Assess checkpoint activation via Western blotting for phosphorylated checkpoint proteins

    • Evaluate inappropriate mitosis rates under hydroxyurea treatment

  • Assess replication fork integrity through techniques such as:

    • DNA combing to visualize individual replication forks

    • Chromatin immunoprecipitation (ChIP) of replication proteins

    • 2D gel electrophoresis to detect replication intermediates

  • Examine genetic interactions through synthetic lethality screening with known replication/repair factors such as Rad11, Rpa1, and Rtf2 .

If SPAC17A2.10c is involved in DNA replication or repair, mutant strains would be expected to show sensitivity to DNA-damaging agents and potentially exhibit checkpoint defects similar to those observed in rad11 mutants .

What experimental approaches are most effective for characterizing the dynamic behavior of SPAC17A2.10c in the plasma membrane?

Membrane protein dynamics are crucial for understanding function. For SPAC17A2.10c, consider these advanced approaches:

  • Fluorescence Recovery After Photobleaching (FRAP): Tag SPAC17A2.10c with a fluorescent protein, photobleach a region of the membrane, and measure the rate of fluorescence recovery to determine protein mobility.

  • Single Particle Tracking (SPT): Use quantum dots or other bright, photostable labels to track individual protein molecules in live cells, revealing diffusion behaviors and potential confinement in membrane domains.

  • Fluorescence Correlation Spectroscopy (FCS): Measure concentration fluctuations of fluorescently labeled proteins to determine diffusion coefficients and potential oligomerization states.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Assess protein dynamics and conformational changes in different membrane environments or interaction states.

  • Stimulated Emission Depletion (STED) microscopy: Monitor protein clustering and nanodomain organization at super-resolution levels .

These techniques should be implemented under various cellular conditions (e.g., different growth phases, stress conditions) to assess context-dependent changes in protein behavior.

How should researchers approach RNA splicing analysis of SPAC17A2.10c to identify potential regulatory mechanisms?

RNA processing can significantly impact membrane protein expression. To investigate SPAC17A2.10c splicing:

  • Design PCR primers spanning predicted intron boundaries (similar to the P7/P8 and P9/P10 primer pairs used for rtf1 intron analysis) .

  • Extract total RNA from S. pombe under different conditions, including:

    • Different cell cycle phases (G1, S, G2, M)

    • Stress conditions (oxidative, temperature, nutrient)

    • DNA damage scenarios

  • Synthesize cDNA using reverse transcriptase and perform PCR to amplify regions containing potential introns.

  • Run products on high-percentage (2%) agarose gels to detect intron retention events .

  • For quantitative analysis, implement RT-qPCR with primers spanning exon-exon junctions versus intron-containing regions.

  • Sequence identified splice variants to confirm intron boundaries and potential alternative splice sites.

  • Validate findings with minigene constructs expressed in S. pombe to assess splicing efficiency under controlled conditions.

This approach can reveal condition-specific regulation of SPAC17A2.10c expression through differential splicing, potentially explaining functional adaptations under varying cellular states.

What are the critical considerations when designing experiments to identify post-translational modifications of SPAC17A2.10c?

Post-translational modifications (PTMs) often regulate membrane protein function and localization. For comprehensive PTM mapping of SPAC17A2.10c:

Table 2: Approaches for identifying post-translational modifications in membrane proteins

PTM typeMethodSample preparationData analysis approach
PhosphorylationPhospho-enrichment + LC-MS/MSTiO₂ or IMAC enrichment of tryptic peptidesIdentify mass shifts of +80 Da, neutral loss of phosphate
GlycosylationGlycosidase treatment + MSTreatment with PNGase F or other glycosidasesCompare untreated vs. treated samples for mass shifts
UbiquitinationImmunoprecipitation with ubiquitin antibodiesLyse cells with deubiquitinase inhibitorsIdentify GG remnant on lysine residues
PalmitoylationAcyl-biotin exchangeBlock free thiols, cleave thioester bonds, label with biotinCompare samples with and without hydroxylamine treatment
Multiple PTMsTop-down proteomicsPurify intact proteinAnalyze intact mass and fragmentation patterns

When designing these experiments:

  • Consider cell cycle dependence: Synchronize cells using techniques like the cdc2asM17 method to capture cell-cycle-specific modifications .

  • Include positive controls: Well-characterized S. pombe membrane proteins with known modifications.

  • Account for potential PTM crosstalk: One modification may influence the presence or absence of others.

  • Validate MS findings: Use site-directed mutagenesis of identified PTM sites followed by functional assays to confirm biological significance.

  • Assess conservation: Compare potential modification sites with homologous proteins in related species to identify evolutionarily conserved regulatory mechanisms.

How can researchers effectively investigate the role of SPAC17A2.10c in replication fork barrier function in S. pombe?

S. pombe contains well-characterized replication fork barriers (RFBs) like RTS1, which are regulated by factors such as Rtf1 and Rtf2 . To determine if SPAC17A2.10c participates in RFB activity:

  • Generate a SPAC17A2.10c deletion strain and assess its impact on known RFB sites using 2D gel electrophoresis to visualize replication intermediates.

  • Create an RFB reporter system by integrating the RTS1 barrier into a non-essential locus and measure barrier activity in wild-type versus SPAC17A2.10c mutant backgrounds.

  • Perform ChIP assays to determine if SPAC17A2.10c is recruited to RFB sites.

  • Measure DSB-independent recombination-dependent replication (RDR) efficiency in SPAC17A2.10c mutants, as this process is known to occur after fork collapse in S. pombe .

  • Analyze replication dynamics through DNA combing before and after hydroxyurea treatment to detect replication abnormalities similar to those observed in rad11 mutants .

The results should be interpreted in the context of known replication barriers and fork stability mechanisms in S. pombe to determine if SPAC17A2.10c functions in maintaining replication integrity.

What approaches should be used to investigate potential nanodomain associations of SPAC17A2.10c in the plasma membrane?

Membrane proteins often organize into functional nanodomains for efficient signaling. To characterize SPAC17A2.10c nanodomain association:

  • Implement super-resolution microscopy techniques (PALM, STORM, STED) to visualize protein clustering beyond the diffraction limit .

  • Perform density gradient centrifugation of membrane fractions to isolate detergent-resistant membranes (DRMs) and analyze SPAC17A2.10c distribution.

  • Use proximity labeling approaches (BioID, APEX) to identify proteins in the immediate vicinity of SPAC17A2.10c within the membrane.

  • Analyze co-localization with known nanodomain markers such as REMORINs, which are established plasma membrane nanodomain proteins .

  • Utilize FRET-based approaches to measure protein-protein proximity within potential nanodomains.

  • Implement advanced computational analyses of single-molecule tracking data to identify confinement zones and characterize hop diffusion between membrane compartments.

  • Assess lipid interactions through lipidomic analysis of immunoprecipitated SPAC17A2.10c complexes to identify enriched lipid species that might facilitate nanodomain formation.

These approaches will help determine if SPAC17A2.10c functions within specialized membrane compartments and identify the molecular components and organizational principles of these domains.

How should researchers integrate multi-omics data to establish the functional network of SPAC17A2.10c?

Uncharacterized proteins like SPAC17A2.10c require integrative approaches to establish their functional context. Researchers should:

  • Combine transcriptomic, proteomic, and interactomic data to build a comprehensive interaction network centered on SPAC17A2.10c.

  • Implement gene ontology (GO) enrichment analysis of identified interactors to reveal biological processes potentially involving SPAC17A2.10c.

  • Perform comparative genomics to identify conserved interaction partners across fungal species, suggesting evolutionary conservation of function.

  • Utilize machine learning approaches to predict functional associations based on known interaction networks in S. pombe.

  • Develop and test hypotheses derived from the integrated data through targeted experimental validation, including genetic interaction screens and phenotypic analyses of mutants.

  • Apply systems biology modeling to predict cellular responses to SPAC17A2.10c perturbation under various experimental conditions.

By integrating these diverse data types, researchers can develop testable hypotheses about the biological role of this uncharacterized membrane protein and design experiments to validate these predictions, ultimately contributing to our understanding of membrane protein function in S. pombe.

What are the best practices for reporting research findings on uncharacterized proteins like SPAC17A2.10c to ensure reproducibility?

When reporting research on uncharacterized proteins, ensure reproducibility by following these guidelines:

  • Provide complete methodological details, including:

    • Strain construction with full genotypes

    • Culture conditions and synchronization procedures

    • Detailed protein purification protocols

    • All buffer compositions and reaction conditions

  • Deposit sequence information in appropriate databases:

    • Nucleotide sequences in GenBank

    • Protein sequences in UniProt

    • Structural data in PDB (if applicable)

  • Share biological materials:

    • Deposit strains in yeast genetic stock centers

    • Make plasmids available through repositories like Addgene

  • Implement appropriate controls:

    • Include positive and negative controls for all experiments

    • Validate key findings using multiple independent methods

    • Assess potential artifacts from protein tags or expression systems

  • Present comprehensive data:

    • Include raw data where appropriate

    • Provide statistical analyses with clear descriptions of tests used

    • Include biological and technical replicates with appropriate sample sizes

  • Document computational analyses:

    • Share code and analysis pipelines

    • Specify versions of software used

    • Provide parameters for all algorithms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.