Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C18E5.14c (SPBC18E5.14c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPBC18E5.14c; Uncharacterized membrane protein C18E5.14c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC18E5.14c
Target Protein Sequence
MTGPFRYNGGSVRSFALTTNFSFPSYDLSFNETEHGVFCYVSRPLTKERSCSHPYISLGS SYGIPDAENIEYPRDARYHSPLLFTVRLLLFSTYWSYSLASQHFKVFTWSKSCKFNYITQ STPWNVAEIKNCFNLFLERLVLILASSGFGFMISLTALDLLDELLNDSSSNMIWLYEVYM LYKTYTSYFFMSSKSFVRGVKRYLIYFCYCANFIALFRVIFGTIFVYSPDGITPFMTDFV RWILIYLKGSINSLLYMASFTKQISLLRGWRTEHAELS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What is SPBC18E5.14c and what structural characteristics have been identified?

SPBC18E5.14c is an uncharacterized membrane protein from the fission yeast Schizosaccharomyces pombe. The full-length protein consists of 278 amino acids and is currently classified as a membrane protein based on sequence analysis and computational predictions . Due to its uncharacterized status, detailed structural information remains limited.

The protein can be recombinantly expressed with a histidine tag, which facilitates purification while maintaining the full-length structure (amino acids 1-278) . Computational analysis suggests it contains transmembrane domains characteristic of integral membrane proteins, though crystal structures have not yet been determined. Researchers often employ secondary structure prediction tools like TMHMM, PSIPRED, or AlphaFold to generate preliminary structural models when working with such uncharacterized proteins.

What expression systems are most effective for recombinant production of SPBC18E5.14c?

Based on current research practices, E. coli expression systems have proven effective for the recombinant production of SPBC18E5.14c with appropriate tags for purification . The recombinant protein is typically expressed with a His-tag to facilitate affinity purification. Several methodological considerations affect successful expression:

  • Codon optimization: Since S. pombe has different codon usage than E. coli, codon optimization may improve expression yields.

  • Expression conditions: Membrane proteins often require lower induction temperatures (16-20°C) and reduced inducer concentrations to prevent aggregation and formation of inclusion bodies.

  • Solubilization strategies: Appropriate detergents or amphipols must be selected to maintain protein stability during extraction from membranes.

  • Alternative expression systems: For proteins that prove difficult to express in E. coli, yeast-based systems (Pichia pastoris) or insect cell systems may provide better results for maintaining native conformation of membrane proteins.

The choice between prokaryotic and eukaryotic expression systems should be based on research requirements for post-translational modifications and proper folding.

How does SPBC18E5.14c compare to other uncharacterized membrane proteins in S. pombe?

Within the S. pombe proteome, SPBC18E5.14c represents one of several uncharacterized membrane proteins that pose similar research challenges. While specific comparative data for SPBC18E5.14c is limited, general patterns observed in the analysis of membrane proteins from S. pombe can provide context:

Membrane proteins in S. pombe often participate in critical cellular processes including transport, signaling, and cell structure maintenance. Approximately 79% of proteins identified through membrane-impermeable chemical probe enrichment techniques in studies of gram-negative bacteria are membrane-localized , and similar enrichment efficiencies may be expected for S. pombe membrane proteins.

When studying SPBC18E5.14c, researchers should consider potential functional relationships with characterized membrane proteins in the same chromosomal region, as proteins in close genomic proximity may have related functions or be co-expressed during specific cellular processes, similar to the regional specificity observed with rec proteins in S. pombe .

What methods can effectively determine the subcellular localization of SPBC18E5.14c?

Determining the subcellular localization of SPBC18E5.14c requires a multi-faceted approach:

  • Fluorescent protein tagging: Creating a SPBC18E5.14c-GFP fusion protein is an effective method for visualizing localization in live cells. The tag should be positioned to minimize interference with protein folding and function (typically C-terminal for membrane proteins).

  • Membrane-impermeable chemical probes: Sulfo-NHS-SS-Biotin and similar probes that cannot penetrate the cell membrane can be used to selectively label cell surface proteins. This approach, coupled with 18O labeling and LC-MS analysis, has proven highly specific for membrane protein enrichment with 79% specificity reported in bacterial systems .

  • Subcellular fractionation: Differential centrifugation followed by Western blotting can identify the membrane fraction containing SPBC18E5.14c.

  • Immunoelectron microscopy: For high-resolution localization, immunogold labeling with antibodies against SPBC18E5.14c or its epitope tag can precisely determine its position within membrane structures.

For membrane proteins like SPBC18E5.14c, localization data can provide critical functional insights. A comparison between wild-type and mutant strains (such as those with deletions in secretion systems) can reveal mechanisms of protein trafficking, similar to studies that identified reduced abundance of certain outer membrane proteins in bacterial type II secretion system mutants .

What functional genomics approaches can help characterize the role of SPBC18E5.14c?

Multiple functional genomics approaches can be applied to uncover the role of SPBC18E5.14c:

  • Comparative genomics: Cross-species analysis comparing SPBC18E5.14c orthologs across related species can provide evolutionary insights and functional predictions. Algorithms that combine co-inertia analysis, back-transformation, and Hungarian matching can identify functional conservation patterns across species .

  • Transcriptome analysis: RNA-seq analysis under various conditions can identify co-regulated genes, suggesting functional relationships. Conditions should include environmental stresses, cell cycle phases, and nutrient limitations.

  • Gene deletion/silencing: Creating a SPBC18E5.14c deletion strain and performing comprehensive phenotypic analysis can reveal functions. Techniques like the negative selection screen used for identifying essential genes can be adapted to study membrane proteins .

  • Synthetic genetic arrays: Systematic crossing of a SPBC18E5.14c deletion with a library of other gene deletions can reveal genetic interactions and parallel pathways.

  • Metabolomic profiling: Comparing metabolite profiles between wild-type and SPBC18E5.14c mutants can reveal metabolic pathways affected by the protein's function.

The integration of these datasets using dynamic Bayesian networks can generate testable hypotheses about SPBC18E5.14c function, as demonstrated in studies of cross-species common gene regulatory networks .

How can protein-protein interaction studies identify functional partners of SPBC18E5.14c?

Several complementary methods can effectively identify interaction partners of SPBC18E5.14c:

  • Affinity purification coupled with mass spectrometry (AP-MS): Using His-tagged SPBC18E5.14c as bait, interacting proteins can be co-purified and identified by mass spectrometry. For membrane proteins, appropriate detergents are crucial to maintain interactions.

  • Proximity-dependent biotin identification (BioID): Fusing SPBC18E5.14c with a biotin ligase allows biotinylation of proximal proteins, which can then be purified and identified, revealing the protein's neighborhood within the cell.

  • Membrane yeast two-hybrid (MYTH): This specialized system for membrane proteins can detect interactions between SPBC18E5.14c and both membrane and soluble proteins.

  • Co-immunoprecipitation: Using antibodies against tagged SPBC18E5.14c to pull down protein complexes, followed by Western blotting or mass spectrometry.

  • Cross-linking mass spectrometry: Chemical cross-linking can capture transient interactions before cell lysis and mass spectrometry analysis.

When analyzing interaction data, it's important to distinguish direct binding partners from components of larger complexes. Integration with localization data is essential, as true interactors must colocalize with SPBC18E5.14c at least temporarily. Validation of key interactions using techniques like FRET (Förster Resonance Energy Transfer) or BiFC (Bimolecular Fluorescence Complementation) is recommended.

What role might SPBC18E5.14c play in meiotic recombination or cell division in S. pombe?

While direct evidence linking SPBC18E5.14c to meiotic recombination is not established in the provided materials, several investigative approaches can test this hypothesis:

  • Expression analysis during meiosis: Comparing SPBC18E5.14c expression levels throughout meiotic progression using RNA-seq or quantitative PCR can reveal meiosis-specific regulation.

  • Localization during meiosis: Tracking GFP-tagged SPBC18E5.14c during meiotic division can identify potential relocalization to sites of recombination.

  • Interaction with recombination machinery: Testing for physical interactions with known recombination proteins like Rec8, Rec10, and Rec11, which show regional specificity in activating meiotic recombination in S. pombe .

  • Phenotypic analysis: Assessing recombination frequencies in SPBC18E5.14c deletion strains, particularly focusing on regional effects similar to those observed with rec mutants that affect specific chromosomal regions .

Previous research has shown that some rec mutants in S. pombe affect recombination only in specific chromosomal regions, with rec10 mutations primarily affecting the ~2-Mb region surrounding the ade6 locus while having minimal effects elsewhere . Determining whether SPBC18E5.14c follows a similar pattern of regional specificity would be illuminating.

What purification strategies yield optimal results for SPBC18E5.14c?

Purifying membrane proteins like SPBC18E5.14c presents unique challenges requiring specialized methodologies:

  • Solubilization optimization: Testing multiple detergents (e.g., DDM, LMNG, CHAPS) at various concentrations is crucial. A detergent screen should be performed to identify conditions that maximize protein extraction while maintaining structural integrity.

  • Two-step affinity purification: For His-tagged SPBC18E5.14c, immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography (SEC) provides high purity while preserving native protein complexes.

  • Detergent exchange: Gradual exchange to milder detergents or amphipols during purification can improve protein stability for downstream applications.

  • Buffer optimization: Systematically testing buffers with varying pH, salt concentration, and stabilizing additives (glycerol, specific lipids) to maximize protein stability.

  • Quality control: Employing multiple methods to assess purified protein quality, including SDS-PAGE, Western blotting, dynamic light scattering to check monodispersity, and circular dichroism to evaluate secondary structure integrity.

For membrane proteins expressed in E. coli, inclusion of S. pombe lipids during purification can help maintain native conformation. Proper handling to avoid aggregation is essential, including keeping samples cold and minimizing freeze-thaw cycles.

How can stable isotope labeling techniques quantify SPBC18E5.14c expression under different conditions?

Stable isotope labeling provides powerful approaches for quantitative analysis of SPBC18E5.14c expression:

  • 18O/16O labeling: This technique allows relative quantification of proteins from different samples. Peptides from one condition are labeled with 18O during digestion, while the other remains unlabeled (16O). The samples are then combined and analyzed by LC-MS, with mass shifts indicating the origin of each peptide .

  • SILAC (Stable Isotope Labeling with Amino acids in Cell culture): Growing S. pombe in media containing heavy isotope-labeled amino acids allows for precise quantification of protein abundance differences between experimental conditions.

  • Targeted proteomics using SRM/MRM: Selected/Multiple Reaction Monitoring can quantify SPBC18E5.14c with high specificity and sensitivity without labeling, using synthetic peptide standards.

When applying these approaches to SPBC18E5.14c, researchers should:

  • Select peptides unique to SPBC18E5.14c for unambiguous identification

  • Include an internal standard for normalization across experiments

  • Compare multiple biological replicates to account for biological variability

  • Consider both global expression changes and alterations in membrane localization

The combination of membrane-impermeable chemical probes with stable isotope labeling has proven effective for quantifying changes in membrane proteomes, as demonstrated in studies comparing wild-type and mutant bacterial strains .

What bioinformatic approaches can predict potential functions of SPBC18E5.14c?

Several complementary bioinformatic approaches can provide functional insights for SPBC18E5.14c:

  • Homology-based annotation: Sequence similarity searches against characterized proteins using PSI-BLAST or HHpred can identify distant homologs with known functions.

  • Domain and motif analysis: Tools like Pfam, PROSITE, and InterPro can identify conserved domains or functional motifs that suggest biochemical activities.

  • Structural prediction: Methods like AlphaFold2 can generate structural models that, when compared to solved structures, may reveal functional similarities not apparent from sequence alone.

  • Co-expression network analysis: Identifying genes consistently co-expressed with SPBC18E5.14c across various conditions can suggest functional associations.

  • Cross-species analysis: Comparing expression patterns and network positions of orthologs across related species can reveal evolutionarily conserved functions .

  • Phylogenetic profiling: Analyzing the pattern of presence/absence of SPBC18E5.14c across species can link it to specific biological processes.

  • Text mining: Natural language processing of scientific literature can uncover implicit connections between SPBC18E5.14c and better-characterized proteins or pathways.

Integration of these diverse analyses using machine learning approaches can provide more robust functional predictions than any single method. Cross-species dynamic Bayesian network analysis has been shown to improve network inference by yielding more significant network motifs compared to single-species analysis .

How should experiments be designed to assess SPBC18E5.14c's role in cellular stress responses?

Designing experiments to evaluate SPBC18E5.14c's potential role in stress responses requires a systematic approach:

  • Strain preparation: Generate the following S. pombe strains:

    • SPBC18E5.14c deletion (knockout) strain

    • SPBC18E5.14c-overexpression strain

    • SPBC18E5.14c tagged variant (GFP/FLAG) for localization and interaction studies

    • Appropriate wild-type control (e.g., FY435 h+ his7-366 leu1-32 ura4-Δ18 ade6-M210)

  • Stress condition panel: Expose strains to multiple stress conditions including:

    • Oxidative stress (H₂O₂, menadione)

    • Osmotic stress (sorbitol, NaCl)

    • Temperature stress (heat shock, cold shock)

    • Nutrient limitation (iron, nitrogen, carbon)

    • Cell wall/membrane stress (SDS, calcofluor white)

  • Phenotypic analysis:

    • Growth curves under different stresses (microplate reader)

    • Spot assays for viability under stress conditions

    • Microscopic analysis of morphological changes

  • Molecular responses:

    • Transcriptomic analysis (RNA-seq) comparing wild-type and mutant responses to stress

    • Proteomic analysis focusing on membrane fraction changes

    • Lipidomic analysis to detect membrane composition alterations

  • Localization dynamics:

    • Live-cell imaging of GFP-tagged SPBC18E5.14c during stress response

    • Co-localization with known stress response markers

A factorial experimental design should be employed to test interactions between different stresses and genetic backgrounds. Statistical analysis should include appropriate corrections for multiple testing, such as FDR adjustment methods used in previous S. pombe studies .

What controls and validations are essential when studying SPBC18E5.14c protein-protein interactions?

Rigorous controls and validations are critical for reliable protein-protein interaction studies with SPBC18E5.14c:

  • Essential experimental controls:

    • Negative controls: Empty vector/unrelated membrane protein with same tag

    • Positive controls: Known stable membrane protein interactions

    • Input controls: Analysis of starting material before purification

    • Validation across methods: Confirm key interactions using orthogonal techniques

  • Validation strategies:

    • Reciprocal co-immunoprecipitation: Perform pull-downs using antibodies against both SPBC18E5.14c and its putative partner

    • Mutational analysis: Introduce mutations in interaction domains to disrupt specific interactions

    • Competitive binding assays: Use peptides derived from interaction interfaces to disrupt binding

    • In vivo functional assays: Test whether phenotypes of individual mutants are epistatic or additive

  • Specificity controls:

    • Detergent panel: Test interactions across multiple detergent conditions to eliminate detergent-specific artifacts

    • Salt sensitivity: Examine interaction stability at different ionic strengths to distinguish specific from non-specific bindings

    • Dose-dependence: Demonstrate saturable binding characteristic of specific interactions

  • Technical considerations:

    • Crosslinking optimization: If using crosslinking approaches, titrate reagent to avoid non-specific aggregation

    • Background subtraction: Use appropriate statistical methods to distinguish true interactors from common contaminants

    • Biological replicates: Perform at least three independent biological replicates for statistical confidence

Similar control strategies have been successfully employed in membrane protein studies using chemical probes and affinity purification, achieving 79% specificity for membrane proteins .

How should contradictory results about SPBC18E5.14c function be reconciled and validated?

When faced with contradictory results regarding SPBC18E5.14c function, a systematic approach to reconciliation and validation is necessary:

  • Source evaluation:

    • Examine methodological differences between contradictory studies

    • Assess genetic background variations in S. pombe strains used

    • Compare experimental conditions (media composition, growth phase, temperature)

  • Targeted validation experiments:

    • Design experiments that directly address the contradiction

    • Use multiple methodological approaches to test the same hypothesis

    • Include appropriate positive and negative controls

    • Conduct experiments in multiple strain backgrounds

  • Quantitative analysis:

    • Apply statistical methods appropriate for the data type, with proper controls for multiple testing

    • Use Bayesian approaches to integrate contradictory data with prior knowledge

    • Consider effect sizes rather than just statistical significance

  • Integration with existing knowledge:

    • Cross-reference with phenotypes of related genes

    • Compare with orthologs in related species

    • Examine protein interaction networks for functional context

  • Independent validation:

    • Collaborate with independent laboratories to replicate key findings

    • Use complementary techniques to validate crucial observations

    • Consider genetic background effects by testing in alternative S. pombe strains like those used in previous studies (e.g., FY435)

When reconciling contradictory results, researchers should avoid confirmation bias and maintain transparent reporting of all experimental conditions and analyses. Meta-analysis approaches like those used in cross-species studies can be adapted to integrate disparate datasets about SPBC18E5.14c.

What statistical approaches are appropriate for analyzing SPBC18E5.14c expression data?

Analyzing SPBC18E5.14c expression data requires appropriate statistical methods tailored to the experimental design:

  • For microarray or RNA-seq differential expression analysis:

    • Apply appropriate normalization methods (e.g., quantile normalization, TMM, or RLE)

    • Use linear models with empirical Bayes methods (limma) or negative binomial models (DESeq2, edgeR)

    • Control for multiple testing using FDR correction methods

    • Consider sample size requirements for adequate statistical power

  • For time-course experiments:

    • Apply methods that account for temporal correlation (e.g., maSigPro, EDGE)

    • Consider autocorrelation between adjacent time points

    • Use functional data analysis approaches for smooth trends

  • For protein quantification data:

    • Account for technical variability in LC-MS measurements

    • Use appropriate normalization with internal standards

    • Apply specialized statistics for ratio-based measurements in stable isotope labeling

  • For integrative analysis:

    • Use dimension reduction techniques like PCA or t-SNE to visualize complex datasets

    • Apply co-inertia analysis for integrating multiple data types

    • Consider Bayesian network approaches for causal relationship inference

  • Experimental design considerations:

    • Include sufficient biological replicates (minimum three, preferably more)

    • Account for batch effects in experimental design and analysis

    • Use power analysis to determine appropriate sample sizes

When analyzing SPBC18E5.14c data in the context of stress responses or genetic perturbations, approaches similar to those used in previous S. pombe studies should be considered, including appropriate statistical computations and FDR adjustment methods .

What are the current knowledge gaps regarding SPBC18E5.14c and priority research directions?

Despite advances in recombinant protein technology and membrane protein analysis, significant knowledge gaps remain regarding SPBC18E5.14c:

  • Current knowledge gaps:

    • Specific biochemical function remains undefined

    • Physiological role within S. pombe cellular processes is unknown

    • Protein interaction partners have not been systematically identified

    • Regulation mechanisms under different cellular conditions are unexplored

    • Three-dimensional structure has not been determined

  • Priority research directions:

    • Systematic phenotypic analysis of SPBC18E5.14c deletion strains under diverse conditions

    • Comprehensive interactome mapping using techniques optimized for membrane proteins

    • Structure determination using cryo-EM or X-ray crystallography

    • Genetic screens to identify synthetic interactions revealing functional pathways

    • Evolutionary analysis across fungi to identify conserved functional regions

  • Methodological priorities:

    • Development of specific antibodies against SPBC18E5.14c for endogenous protein studies

    • Optimization of membrane protein crosslinking approaches for interaction studies

    • Application of advanced microscopy techniques to study dynamics and localization

    • Integration of multiple omics datasets to contextualize SPBC18E5.14c function

  • Long-term research goals:

    • Complete functional characterization within the S. pombe membrane proteome

    • Understanding of evolutionary conservation and divergence across fungal species

    • Potential applications in biotechnology if unique properties are identified

Addressing these priorities will require interdisciplinary approaches combining genetics, biochemistry, structural biology, and computational methods. Successful characterization of previously uncharacterized membrane proteins has often followed such integrated research strategies, revealing unexpected cellular functions and potential biotechnological applications.

How can researchers effectively integrate findings about SPBC18E5.14c into broader understanding of S. pombe biology?

Integrating SPBC18E5.14c findings into the broader context of S. pombe biology requires systematic approaches:

  • Contextualizing within known pathways:

    • Map SPBC18E5.14c interactions onto established cellular pathways

    • Identify potential roles in known biological processes like cell division, meiosis, or stress response

    • Compare phenotypes with those of genes in related pathways

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and metabolomic data to build functional networks

    • Apply machine learning approaches to predict functional relationships

    • Use cross-species meta-analysis methods to leverage comparative genomics

  • Community resource contribution:

    • Submit standardized data to community databases like PomBase

    • Follow consistent nomenclature and annotation standards

    • Share reagents, strains, and protocols to facilitate reproducibility

  • Systematic literature analysis:

    • Use text mining tools to identify implicit connections in published literature

    • Create network visualizations integrating published and new findings

    • Develop testable hypotheses based on integrated knowledge

  • Evolutionary perspective:

    • Compare with orthologs in other fungi to distinguish conserved from species-specific functions

    • Consider potential roles in fungal-specific processes versus general cellular functions

    • Examine patterns of selection pressure to identify functionally important regions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.