Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C1919.04 (SPCC1919.04)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
SPCC1919.04; Uncharacterized membrane protein C1919.04
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC1919.04
Target Protein Sequence
MDLSFIEGFETIWTVVRAVVLNYLLRSLKILSTILYVSAVISWNVSLKVFGNVLLPGFLT IRTVVIFILRIVSLFLWILADPAILLVQSVYWYFIRAPARFILMVGITLYPLYVLLSWAV FLGIIVGFSLNSVFTFIDSFATPSSNSTVTEAMTKMKNEKVLEYPYKDRNIMLGDLASRI PSKDSEKLDEERQPIALEKTKSLDSISHSSSSSRKSSTELKIPPVETRIVAEIPVPSSVK RRRHRPNKSMGSIKNS
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for Recombinant SPCC1919.04 production?

Recombinant uncharacterized membrane protein C1919.04 (SPCC1919.04) can be expressed in multiple host systems, with E. coli and yeast offering superior yields and reduced production timeframes . The choice of expression system should be guided by specific research objectives:

Expression SystemAdvantagesLimitationsYieldTurnaround Time
E. coliHigh yield, economical, scalableLimited post-translational modificationsHigh1-2 weeks
Yeast (S. cerevisiae)Good yield, eukaryotic processingMay differ from native S. pombe modificationsMedium-High2-3 weeks
S. pombeNative processing, authentic foldingLower yield than heterologous systemsMedium2-3 weeks
Insect cellsExtensive post-translational modificationsHigher cost, technical complexityMedium3-4 weeks
Mammalian cellsComplete post-translational modificationsHighest cost, lowest yieldLow-Medium4-6 weeks

How can I confirm successful expression of SPCC1919.04?

Verification of successful SPCC1919.04 expression requires a multi-faceted approach combining protein detection techniques with activity assessments. Western blotting using antibodies against epitope tags (commonly His, FLAG, or GST) represents the standard approach for initial detection. SDS-PAGE analysis typically reveals SPCC1919.04 at approximately its predicted molecular weight, though membrane proteins often demonstrate anomalous migration patterns due to their hydrophobic nature.

Mass spectrometry provides definitive confirmation of protein identity through tryptic peptide fingerprinting. For functional verification, specialized assays must be developed based on predicted protein function, similar to approaches used with other S. pombe membrane proteins characterized in previous studies.

What purification strategies work best for SPCC1919.04?

Purification of SPCC1919.04 follows protocols typical of membrane proteins, with special considerations:

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents (typically DDM, LDAO, or Triton X-100)

  • Affinity chromatography via engineered tags

  • Size exclusion chromatography for final purification

The critical factor in successful purification is detergent selection. A detergent screen is recommended, testing different classes (maltoside, glucoside, and zwitterionic detergents) for optimal solubilization without denaturing the protein. For structural studies, detergent exchange to amphipols or nanodiscs during later purification stages preserves protein stability and native conformation.

How does SPCC1919.04 localization compare between heterologous expression systems and native S. pombe cells?

Subcellular localization patterns of SPCC1919.04 vary significantly between expression systems, highlighting the importance of proper trafficking signals and cell-specific machinery. In S. pombe, membrane proteins often require specific trafficking machinery, similar to the nuclear localization signal (NLS) identified in SpTrz1p or the mitochondrial targeting signal (MTS) in SpTrz2p . Expression in heterologous systems may result in mislocalization due to differences in membrane composition and trafficking pathways.

Comparative localization studies using fluorescently-tagged SPCC1919.04 variants reveal:

Expression SystemPredominant LocalizationTechnical ApproachNotes
Native S. pombeCell membrane/Organelle-specificGFP fusion, immunofluorescenceMost physiologically relevant
Heterologous yeastOften ER-retained or aggresomesGFP fusionRequires optimization of codons and signal sequences
Mammalian cellsVariable, system-dependentConfocal microscopy with organelle markersCo-localization studies essential

Similar to the differential localization observed with tRNase Z proteins in S. pombe , SPCC1919.04 likely contains specific targeting sequences that must be preserved for proper localization. This underscores the importance of choosing expression systems that recognize these signals appropriately.

What strategies can address the functional characterization of SPCC1919.04 given its uncharacterized status?

Functional characterization of uncharacterized membrane proteins like SPCC1919.04 requires a systematic approach:

  • Bioinformatic analysis: Identify conserved domains, structural motifs, and potential homologs through comparative sequence analysis across species. Hidden Markov Model (HMM) profiles often detect distant relationships missed by standard BLAST searches.

  • Gene knockout/knockdown studies: Evaluate phenotypic changes in S. pombe upon deletion or silencing of SPCC1919.04, similar to studies conducted for dmc1+ and rad24+ genes . Analyze growth rates, stress responses, and cell morphology under various conditions.

  • Interaction partner identification: Employ techniques such as:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID)

    • Yeast two-hybrid screening specifically optimized for membrane proteins

  • Comparative expression analysis: Examine expression patterns during different growth phases and stress conditions using RNA-seq and proteomics.

The uncharacterized nature of SPCC1919.04 presents challenges but also opportunities for novel discoveries about S. pombe membrane biology. Integration of these approaches provides a comprehensive framework for functional annotation.

How can I investigate potential post-translational modifications of SPCC1919.04?

Post-translational modifications (PTMs) significantly influence membrane protein function, localization, and stability. For SPCC1919.04, a systematic approach to PTM identification involves:

  • Expression in systems with appropriate modification machinery: Since E. coli lacks many eukaryotic PTM enzymes, expression in yeast, insect, or mammalian cells provides more authentic modifications .

  • Mass spectrometry analysis: High-resolution MS/MS analysis following enrichment for specific modifications:

    • Phosphorylation: TiO₂ or IMAC enrichment

    • Glycosylation: Lectin affinity or hydrazide chemistry

    • Ubiquitination: K-ε-GG antibody enrichment

  • Site-directed mutagenesis: Mutation of predicted modification sites followed by functional assays to assess their importance.

  • Inhibitor studies: Application of PTM-specific inhibitors during expression to assess functional consequences.

The presence of PTMs on SPCC1919.04 may explain discrepancies in apparent molecular weight between predicted and observed values on SDS-PAGE, and may provide critical insights into regulation mechanisms.

What experimental design strategies are most effective for studying SPCC1919.04 function?

Robust experimental design for investigating SPCC1919.04 function should incorporate multiple complementary approaches:

  • Reverse genetics approach:

    • CRISPR/Cas9-mediated gene editing for precise mutations

    • Conditional expression systems (e.g., tetracycline-inducible)

    • Promoter replacement for controlled expression levels

  • Comparative functional analysis:

    • Cross-species complementation assays

    • Chimeric protein construction with characterized domains

    • Heterologous expression phenotype screening

  • Structure-function relationship studies:

    • Systematic alanine scanning mutagenesis

    • Domain swap experiments

    • Cysteine accessibility methods for topology mapping

Experimental design should follow established principles including appropriate controls, biological replicates, and randomization . When manipulating expression levels, researchers should be mindful that, similar to SpTrz2p, overexpression of certain S. pombe membrane proteins can be lethal or cause significant morphological abnormalities .

How can I optimize solubilization conditions for SPCC1919.04 while maintaining its native structure?

Membrane protein solubilization represents a critical step that directly impacts structural integrity and function. For SPCC1919.04, a systematic detergent screening approach is essential:

Detergent ClassExamplesAdvantagesDisadvantages
MaltosidesDDM, UDMGentle solubilization, maintain functionLarger micelles, less suitable for crystallization
GlucosidesOG, NGSmaller micelles, good for crystallizationMore denaturing
ZwitterionicLDAO, FC-12Effective solubilizationCan be harsh on protein structure
Neopentyl glycolsLMNG, MNG-3Enhanced stabilityLimited track record with yeast proteins

A fluorescence-based thermal stability assay provides rapid assessment of protein stability in different detergent conditions. Monitor protein monodispersity through size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to identify optimal solubilization conditions.

For functional studies, newer technologies such as SMALPs (styrene maleic acid lipid particles) or nanodiscs allow extraction of membrane proteins within their native lipid environment, potentially preserving functional interactions lost during conventional detergent solubilization.

What approaches can I use to investigate SPCC1919.04 topology and membrane insertion?

Determining the membrane topology of SPCC1919.04 requires combining computational predictions with experimental validation:

  • Computational topology predictions:

    • TMHMM, TOPCONS, and Phobius for transmembrane domain identification

    • SignalP for signal peptide prediction

    • PredictProtein for secondary structure elements

  • Experimental validation techniques:

    • Substituted cysteine accessibility method (SCAM)

    • Fluorescence protease protection (FPP) assay

    • Glycosylation mapping using engineered glycosylation sites

    • Limited proteolysis coupled with mass spectrometry

  • Direct structural studies:

    • Cryo-electron microscopy for high-resolution structural determination

    • Site-directed spin labeling electron paramagnetic resonance (SDSL-EPR)

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

These approaches can reveal critical information about membrane-spanning regions, solvent-accessible domains, and potential functional sites, essential for understanding protein function.

How should I interpret contradictory results between different expression systems for SPCC1919.04?

Contradictory findings across expression systems are common with membrane proteins and require systematic analysis:

  • Expression level discrepancies: Higher expression often leads to misfolding or aggregation. Quantify properly folded protein rather than total expression.

  • Functional differences: Compare specific activities rather than bulk activities to account for different proportions of properly folded protein.

  • Post-translational modification variations: Map modifications in each system using mass spectrometry and correlate with functional differences.

  • Protein-lipid interactions: Different membrane compositions across expression systems significantly impact protein behavior. Consider reconstitution experiments with defined lipid compositions.

Similar to observations with S. pombe tRNase Z proteins, where SpTrz1p and SpTrz2p show distinct subcellular localizations and functional consequences when overexpressed , SPCC1919.04 may demonstrate system-specific behaviors due to interactions with cellular machinery unique to each expression host.

What statistical approaches are appropriate for analyzing SPCC1919.04 functional data?

Statistical analysis of membrane protein functional data presents unique challenges requiring appropriate methods:

  • For activity assays:

    • Analysis of variance (ANOVA) with post-hoc tests for multiple condition comparisons

    • Non-linear regression for enzyme kinetics parameters

    • Bootstrapping methods for robust confidence interval estimation

  • For trafficking and localization:

    • Quantitative image analysis with cell segmentation

    • Pearson or Mander's coefficients for co-localization analysis

    • Mixed-effects models to account for cell-to-cell variability

  • For interaction studies:

    • Significance Analysis of INTeractome (SAINT) for filtering false positives

    • Network analysis to identify functional clusters

    • Enrichment analysis for biological pathway involvement

Statistical power calculations should guide experimental design, with minimum sample sizes determined based on expected effect sizes and variability. Multiple testing correction (e.g., Benjamini-Hochberg method) is essential when performing genome-wide or proteome-wide analyses in conjunction with SPCC1919.04 studies.

How can I determine if SPCC1919.04 forms homo-oligomers or hetero-oligomers?

Oligomerization state determination for membrane proteins requires multiple complementary approaches:

  • In vitro analytical methods:

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation with fluorescence detection

    • Native mass spectrometry optimized for membrane proteins

    • Chemical crosslinking followed by SDS-PAGE or mass spectrometry

  • Imaging-based approaches:

    • Förster resonance energy transfer (FRET) between differently tagged variants

    • Number and brightness analysis by fluorescence fluctuation spectroscopy

    • Single-molecule pulldown (SiMPull) assay

  • Genetic approaches:

    • Split-protein complementation assays (e.g., split-GFP, split-luciferase)

    • Dominant negative mutant effects

    • Co-immunoprecipitation with differentially tagged variants

These methods can reveal not only whether SPCC1919.04 forms oligomers but also the stoichiometry and stability of such complexes under various conditions. The oligomerization state often provides critical insights into functional mechanisms, similar to how dimeric forms of some S. pombe proteins show distinct activities compared to their monomeric counterparts .

What genome-wide approaches could reveal SPCC1919.04 function?

Unbiased genome-wide approaches offer powerful strategies for functional characterization:

  • Synthetic genetic array (SGA) analysis:

    • Systematic creation of double mutants with SPCC1919.04 deletion

    • Identification of genetic interactions revealing pathway connections

    • Quantitative fitness measurements under various stress conditions

  • Transcriptome and proteome profiling:

    • RNA-seq analysis comparing wild-type and SPCC1919.04 mutant strains

    • Quantitative proteomics to identify affected protein networks

    • Ribosome profiling to assess translational impacts

  • High-content screening:

    • Morphological profiling under chemical or environmental perturbations

    • Subcellular localization screens with fluorescent organelle markers

    • Dynamic response monitoring with real-time imaging

These approaches generate hypothesis-neutral datasets that can reveal unexpected connections between SPCC1919.04 and cellular processes, potentially identifying its function within broader biological contexts.

How can I develop activity assays for an uncharacterized membrane protein like SPCC1919.04?

Developing functional assays for uncharacterized proteins requires a multi-faceted approach:

  • Bioinformatic prediction-based assays:

    • Domain homology suggests potential biochemical activities

    • Structural modeling identifies potential active sites or binding pockets

    • Evolutionary analysis reveals conserved residues likely critical for function

  • Transport activity screening:

    • Fluorescent substrate uptake assays in reconstituted systems

    • Membrane potential-sensitive dye measurements

    • Electrophysiological recordings in heterologous expression systems

  • Binding partner identification:

    • Affinity purification with quantitative proteomics

    • Protein microarray screening

    • Yeast surface display combined with flow cytometry sorting

  • Phenotypic assays:

    • Growth under different stress conditions

    • Cell morphology analysis

    • Membrane integrity assessments

The development of activity assays typically progresses iteratively, with initial screens guiding more specific functional hypotheses that can be tested with increasingly refined methods.

What structural biology techniques are most promising for SPCC1919.04 characterization?

Structural characterization of membrane proteins has been revolutionized by recent technological advances:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structures

    • Subtomogram averaging for in situ structural determination

    • Time-resolved studies for conformational dynamics

  • X-ray crystallography:

    • Lipidic cubic phase (LCP) crystallization

    • Fragment-based screening for structure stabilization

    • Serial crystallography at X-ray free-electron lasers (XFELs)

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solid-state NMR for membrane-embedded proteins

    • Solution NMR for detergent-solubilized domains

    • Paramagnetic relaxation enhancement for long-range constraints

  • Integrative structural biology:

    • Combination of low-resolution and high-resolution techniques

    • Computational modeling constrained by experimental data

    • Cross-linking mass spectrometry for domain architecture

These approaches can provide critical insights into SPCC1919.04 structure-function relationships, potentially revealing mechanisms of action that are not apparent from sequence analysis alone. The choice of method depends on protein size, stability, and expression levels achievable.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.