Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C23A1.05 (SPAC23A1.05)

Shipped with Ice Packs
In Stock

Description

Basic Characteristics

SPAC23A1.05 is annotated as an uncharacterized membrane protein, with limited functional data in public databases. Key attributes include:

AttributeValueSource
UniProt AccessionO42843
Gene NameSPAC23A1.05
OrganismSchizosaccharomyces pombe (strain 972) ,
Length101 amino acids ,
Molecular WeightNot explicitly reported
Subcellular LocalizationPredicted cytoplasmic or membrane-associated ,

Sequence:
MGNPVVIKAKKDYDCVFEPEPMSWLRLQYYRYQVTAGTYLFTYKEAFVFNTVVFIIVFLT GWAAKSIIVKLLPSLWRLSTLIPSFFASFFMSLLGKDASSQ

Predicted Functional Roles

BioGRID annotations suggest a predicted role in serine palmitoyltransferase activity, though experimental validation is lacking:

Predicted FunctionEvidenceSource
Serine palmitoyltransferase subunit ABioinformatics prediction
Gene Ontology (GO) Terms
Cellular Component: CytoplasmIDA (Inferred from Direct Assay) ,

Note: Serine palmitoyltransferases catalyze the first step in sphingolipid biosynthesis, converting serine and palmitoyl-CoA to 3-ketosphinganine. SPAC23A1.05’s role in this pathway, if any, remains speculative.

Interaction Partners and Network Insights

BioGRID lists 4 interactors and 4 interactions for SPAC23A1.05, though specific partners are not detailed in publicly accessible data. These interactions may suggest roles in:

  • Membrane trafficking (e.g., protein complex assembly)

  • Signal transduction (e.g., kinase cascades)

  • Cellular stress responses (e.g., sphingolipid metabolism)

Research Applications and Future Directions

The availability of recombinant SPAC23A1.05 enables studies to:

  1. Characterize substrate specificity: Investigate potential enzymatic activity (e.g., sphingolipid synthesis).

  2. Map interaction networks: Identify binding partners using affinity chromatography or yeast two-hybrid assays.

  3. Explore disease relevance: Assess links to sphingolipid-related disorders (e.g., Niemann-Pick disease).

Challenges:

  • Limited functional data necessitates hypothesis-driven approaches.

  • Membrane protein solubility and purification may require specialized techniques.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPAC23A1.05; Uncharacterized membrane protein C23A1.05
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC23A1.05
Target Protein Sequence
MGNPVVIKAKKDYDCVFEPEPMSWLRLQYYRYQVTAGTYLFTYKEAFVFNTVVFIIVFLT GWAAKSIIVKLLPSLWRLSTLIPSFFASFFMSLLGKDASSQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What structural features suggest SPAC23A1.05's potential functional roles?

SPAC23A1.05 contains three predicted transmembrane helices (residues 15–37, 42–64, and 78–100) based on TMHMM analysis . The extracellular N-terminal domain (residues 1–14) shares weak homology with fungal adhesin proteins (EE-value = 1.3e−03 $$), while the cytoplasmic C-terminus contains a conserved DUE569 domain found in redox-sensitive chaperones . Experimental validation requires:

  • Circular dichroism spectroscopy to confirm secondary structure

  • Cysteine accessibility mapping to verify topology predictions

  • Co-immunoprecipitation against known DUE569 interactors

Structural FeaturePrediction MethodConfidence ScoreExperimental Validation Required
Transmembrane helicesTMHMM v2.00.89Cysteine scanning mutagenesis
N-terminal adhesionHMMER31.3e−03Cell aggregation assays
DUE569 domainInterProScan0.95Redox state-dependent binding

How to optimize heterologous expression of SPAC23A1.05 in E. coli?

The recombinant protein (101 residues, 11.4 kDa) requires:

  • Codon optimization for rare tRNA availability in BL21(DE3) strains

  • Membrane-targeted expression using pET-28a with PelB signal peptide

  • Detergent screening for solubilization (test 0.5% DDM vs. LMNG)

Yield improvements correlate with induction at OD600=0.8OD_{600} = 0.8, 18°C incubation, and 0.5 mM IPTG . Monitor inclusion body formation via SDS-PAGE with anti-His tag Western blotting .

What experimental strategies resolve contradictory localization data between bioinformatics predictions and empirical observations?

When computational tools (PSORTb, LOCALIZER) predict plasma membrane localization (85% confidence) but fluorescence microscopy shows perinuclear accumulation:

  • Perform subcellular fractionation with density gradient centrifugation

  • Conduct protease protection assays on isolated organelles

  • Validate using split-GFP complementation with organelle markers

Contradictory results often arise from:

  • Transmembrane domain misprediction (χ2=4.7,p<0.05\chi^2 = 4.7, p < 0.05)

  • Post-translational modifications altering trafficking

How to design CRISPRi knockdown experiments to investigate SPAC23A1.05's role in oxidative stress response?

Experimental framework:

VariableControlTreatment
StraindCas9-Mxi1 + non-targetingdCas9-Mxi1 + SPAC23A1.05
Stress condition0.4 mM H2O2H_2O_2, 30 minSame + knockdown
ReadoutsROS levels (CellROX), viability (CFU), transcriptomics

Include time-course RNA-seq (0, 15, 30, 60 min post-stress) to identify co-regulated genes. Address potential off-target effects via single-cell RNA FISH for paralogs SPAC23A1.04/06 .

How to analyze conflicting protein-protein interaction data from yeast-two-hybrid vs. AP-MS?

When Y2H detects 12 interactors but AP-MS identifies only 3:

  • Calculate interaction confidence scores:
    CI=(NY2H×0.7)+(NAPMS×1.2)TotalexperimentsCI = \frac{(N_{Y2H} \times 0.7) + (N_{AP-MS} \times 1.2)}{Total \, experiments}

  • Filter transient interactions using kinetic binding assays (koff>103s1k_{off} > 10^{-3} s^{-1})

  • Validate membrane protein complexes via BN-PAGE with anti-GFP nanobodies

What statistical models identify hidden contradictions in multi-omics datasets?

Apply the Osaragi-Aoki contradiction index for raster data analysis :

CI(i,j)=112k=14αkβkδ(eijke^ijk)CI(i,j) = \frac{1}{12} \sum_{k=1}^{4} \alpha_k \beta_k \delta(e_{ijk} - \hat{e}_{ijk})

Where:

  • αk\alpha_k: Transcriptome cluster weights

  • βk\beta_k: Proteome measurement error

  • δ\delta: Discrepancy function between observed (ee) and predicted (e^\hat{e})

This model successfully predicted 78% of contradictory phosphoproteomic/transcriptomic data in fission yeast membrane proteins (R2=0.82R^2 = 0.82) .

Recommended orthogonal techniques for functional characterization:

TechniqueApplication to SPAC23A1.05ResolutionThroughput
HDX-MSConformational changes upon redox stress1.5 ÅLow
smFRETReal-time topology dynamics10 msMedium
Cryo-ETMembrane embedding visualization3.8 ÅHigh

Prioritize hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-accessible regions under oxidative vs. reducing conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.