SPAC23A1.05 is annotated as an uncharacterized membrane protein, with limited functional data in public databases. Key attributes include:
Sequence:
MGNPVVIKAKKDYDCVFEPEPMSWLRLQYYRYQVTAGTYLFTYKEAFVFNTVVFIIVFLT GWAAKSIIVKLLPSLWRLSTLIPSFFASFFMSLLGKDASSQ
BioGRID annotations suggest a predicted role in serine palmitoyltransferase activity, though experimental validation is lacking:
| Predicted Function | Evidence | Source |
|---|---|---|
| Serine palmitoyltransferase subunit A | Bioinformatics prediction | |
| Gene Ontology (GO) Terms | ||
| Cellular Component: Cytoplasm | IDA (Inferred from Direct Assay) | , |
Note: Serine palmitoyltransferases catalyze the first step in sphingolipid biosynthesis, converting serine and palmitoyl-CoA to 3-ketosphinganine. SPAC23A1.05’s role in this pathway, if any, remains speculative.
BioGRID lists 4 interactors and 4 interactions for SPAC23A1.05, though specific partners are not detailed in publicly accessible data. These interactions may suggest roles in:
Membrane trafficking (e.g., protein complex assembly)
Signal transduction (e.g., kinase cascades)
Cellular stress responses (e.g., sphingolipid metabolism)
The availability of recombinant SPAC23A1.05 enables studies to:
Characterize substrate specificity: Investigate potential enzymatic activity (e.g., sphingolipid synthesis).
Map interaction networks: Identify binding partners using affinity chromatography or yeast two-hybrid assays.
Explore disease relevance: Assess links to sphingolipid-related disorders (e.g., Niemann-Pick disease).
Limited functional data necessitates hypothesis-driven approaches.
Membrane protein solubility and purification may require specialized techniques.
KEGG: spo:SPAC23A1.05
STRING: 4896.SPAC23A1.05.1
SPAC23A1.05 contains three predicted transmembrane helices (residues 15–37, 42–64, and 78–100) based on TMHMM analysis . The extracellular N-terminal domain (residues 1–14) shares weak homology with fungal adhesin proteins (-value = 1.3e−03 $$), while the cytoplasmic C-terminus contains a conserved DUE569 domain found in redox-sensitive chaperones . Experimental validation requires:
Circular dichroism spectroscopy to confirm secondary structure
Cysteine accessibility mapping to verify topology predictions
Co-immunoprecipitation against known DUE569 interactors
| Structural Feature | Prediction Method | Confidence Score | Experimental Validation Required |
|---|---|---|---|
| Transmembrane helices | TMHMM v2.0 | 0.89 | Cysteine scanning mutagenesis |
| N-terminal adhesion | HMMER3 | 1.3e−03 | Cell aggregation assays |
| DUE569 domain | InterProScan | 0.95 | Redox state-dependent binding |
The recombinant protein (101 residues, 11.4 kDa) requires:
Codon optimization for rare tRNA availability in BL21(DE3) strains
Membrane-targeted expression using pET-28a with PelB signal peptide
Detergent screening for solubilization (test 0.5% DDM vs. LMNG)
Yield improvements correlate with induction at , 18°C incubation, and 0.5 mM IPTG . Monitor inclusion body formation via SDS-PAGE with anti-His tag Western blotting .
When computational tools (PSORTb, LOCALIZER) predict plasma membrane localization (85% confidence) but fluorescence microscopy shows perinuclear accumulation:
Perform subcellular fractionation with density gradient centrifugation
Conduct protease protection assays on isolated organelles
Validate using split-GFP complementation with organelle markers
Contradictory results often arise from:
| Variable | Control | Treatment |
|---|---|---|
| Strain | dCas9-Mxi1 + non-targeting | dCas9-Mxi1 + SPAC23A1.05 |
| Stress condition | 0.4 mM , 30 min | Same + knockdown |
| Readouts | ROS levels (CellROX), viability (CFU), transcriptomics |
Include time-course RNA-seq (0, 15, 30, 60 min post-stress) to identify co-regulated genes. Address potential off-target effects via single-cell RNA FISH for paralogs SPAC23A1.04/06 .
When Y2H detects 12 interactors but AP-MS identifies only 3:
Calculate interaction confidence scores:
Filter transient interactions using kinetic binding assays ()
Validate membrane protein complexes via BN-PAGE with anti-GFP nanobodies
Apply the Osaragi-Aoki contradiction index for raster data analysis :
Where:
: Transcriptome cluster weights
: Proteome measurement error
: Discrepancy function between observed () and predicted ()
This model successfully predicted 78% of contradictory phosphoproteomic/transcriptomic data in fission yeast membrane proteins () .
| Technique | Application to SPAC23A1.05 | Resolution | Throughput |
|---|---|---|---|
| HDX-MS | Conformational changes upon redox stress | 1.5 Å | Low |
| smFRET | Real-time topology dynamics | 10 ms | Medium |
| Cryo-ET | Membrane embedding visualization | 3.8 Å | High |
Prioritize hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-accessible regions under oxidative vs. reducing conditions .