Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C31G5.07 (SPAC31G5.07)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Properties

ParameterDetails
Host OrganismE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for stability
Storage-20°C/-80°C (long-term), 4°C for short-term aliquots

The recombinant protein is optimized for structural studies and biochemical assays. Its high purity and stability make it suitable for applications such as X-ray crystallography, NMR, or membrane protein interaction studies.

Potential Roles

While dni1 lacks functional annotation, its classification as a membrane protein suggests involvement in:

  • Membrane Trafficking: Coordination of vesicle transport or fusion events.

  • Cellular Stress Response: Adaptation to nitrogen starvation (implied by the synonym "Delayed minus-nitrogen induction protein 1") .

  • Protein-Protein Interactions: Mediation of interactions with other membrane-bound complexes.

Research Challenges

  • Limited Functional Data: No direct experimental evidence links dni1 to specific pathways.

  • Interaction Partners: No validated interactors identified in public databases .

  • Structural Elucidation: Predicted β-sheet domains (via ProtRAP-LM) may guide structural studies, but experimental confirmation is needed .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag type is required, please inform us, and we will prioritize its development.
Synonyms
dni1; SPAC31G5.07; Cell fusion protein dni1; Delayed minus-nitrogen induction protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-234
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
dni1
Target Protein Sequence
STTSKFQLFSLATNVAQINVGYFNMCVLSANATLICKPQFTGCPGLTSISLTDVRSKFLI NEVHPWMIVFSFCVCGVSFLMGVVSSLPLIGRLEFLRNIRISLSFFSFFSILVTALFAHV AVSSFVMAVGNGTQNRVTASLGKKAMIFLWCSMGLVTLTGITDSIILLVTSRTKKIRKTI LEKSKVLTPSSSFSSKSSTTKY
Uniprot No.

Target Background

Function

This cell membrane protein plays a crucial role in coordinating membrane organization and cell wall remodeling during mating.

Gene References Into Functions
  1. Studies suggest that Prm1p and Dni proteins have distinct functions in maintaining proper membrane organization, especially during cell fusion. PMID: 24514900
Database Links
Protein Families
SUR7 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell tip. Note=Localizes to the tip of shmoos which requires fus1, actin and lipid rafts.

Q&A

What is known about the gene structure and expression patterns of SPAC31G5.07?

The dni1 gene is encoded on chromosome II of S. pombe. Expression analysis indicates that dni1 transcription is induced during nitrogen starvation conditions, consistent with its name "Delayed minus-nitrogen induction protein 1." The protein shows spatiotemporal regulation with higher expression during mating and cell fusion processes. Deletion library studies have shown that the gene is not essential for vegetative growth, as deletion mutants could be generated, though they initially presented revival difficulties in the Bioneer deletion library .

What are the recommended expression systems for producing recombinant SPAC31G5.07?

For recombinant production of SPAC31G5.07, E. coli expression systems have been successfully employed. The protein is typically expressed with an N-terminal His-tag for purification purposes. The recommended protocol involves:

  • Cloning the coding sequence (amino acids 33-234) into a bacterial expression vector containing an N-terminal His-tag

  • Transforming into an E. coli expression strain (BL21 or similar)

  • Inducing expression with IPTG at reduced temperature (16-18°C) to minimize inclusion body formation

  • Harvesting cells and purifying using nickel affinity chromatography

Alternative expression systems include yeast (particularly native S. pombe), baculovirus-infected insect cells, or mammalian cell systems for more native-like post-translational modifications .

What purification challenges are specific to SPAC31G5.07 and how can they be addressed?

As a membrane protein, SPAC31G5.07 presents several purification challenges:

  • Solubility Issues: The hydrophobic transmembrane domains make the protein difficult to solubilize. Solution: Use appropriate detergents (e.g., DDM, CHAPS, or Triton X-100) during lysis and purification.

  • Protein Stability: The protein may be unstable once extracted from the membrane. Solution: Add glycerol (5-50%) to stabilize the protein and use Tris/PBS-based buffers with pH 8.0.

  • Aggregation: Tendency to form aggregates. Solution: Perform size exclusion chromatography as a final purification step and maintain low protein concentrations (0.1-1.0 mg/mL).

  • Storage Sensitivity: Repeated freeze-thaw cycles cause degradation. Solution: Aliquot the purified protein and store at -20°C/-80°C with 50% glycerol for long-term storage. Working aliquots can be stored at 4°C for up to one week .

What experimental approaches are most suitable for investigating SPAC31G5.07 function?

To investigate SPAC31G5.07 function, a multi-faceted experimental approach is recommended:

  • Gene Deletion/Disruption: Create knockout mutants using PCR-based gene deletion procedures and analyze phenotypes under various conditions, particularly nitrogen starvation.

  • Protein Localization: Use GFP or other fluorescent tags to determine subcellular localization during vegetative growth and under nitrogen starvation conditions.

  • Protein-Protein Interaction Studies:

    • Immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid assays

    • Proximity labeling approaches (BioID or APEX)

  • Functional Complementation: Test if the protein can functionally complement related proteins in other organisms.

  • Conditional Expression: Use regulatable promoters to control expression levels and timing.

  • Domain-Specific Mutations: Perform site-directed mutagenesis of key residues to identify functional domains .

How should researchers design experiments to characterize SPAC31G5.07 under nitrogen starvation conditions?

To characterize SPAC31G5.07 under nitrogen starvation:

  • Culture Preparation:

    • Grow S. pombe cells in rich medium to mid-log phase

    • Wash cells and transfer to nitrogen-free medium

    • Collect samples at regular intervals (0, 1, 2, 4, 8, 24 hours)

  • Expression Analysis:

    • Perform RT-qPCR to measure transcript levels

    • Western blotting to monitor protein levels

    • Use fluorescently tagged protein to visualize localization changes

  • Phenotypic Assessment:

    • Compare wild-type and dni1 deletion strains for:

      • Mating efficiency

      • Cell fusion rates

      • Sporulation efficiency

      • Cell morphology changes

  • Experimental Controls:

    • Include positive controls (genes known to respond to nitrogen starvation)

    • Use multiple biological replicates

    • Verify nitrogen depletion using established markers

  • Data Collection Table Design:

Time PointWild-type ExpressionΔdni1 ExpressionWild-type Mating EfficiencyΔdni1 Mating EfficiencyWild-type LocalizationΔdni1 Localization
0 hr
1 hr
2 hr
4 hr
8 hr
24 hr
  • Advanced Measurement: Use synchronized cultures to determine if response is cell-cycle dependent .

How can researchers employ ChIP-seq to identify genomic binding sites of SPAC31G5.07?

Although SPAC31G5.07 is a membrane protein and not expected to directly bind DNA, if research suggests potential chromatin association (perhaps via interactions with DNA-binding proteins), ChIP-seq could be employed as follows:

  • Sample Preparation:

    • Cross-link proteins to DNA using formaldehyde (1% for 10 minutes)

    • Lyse cells and sonicate to shear chromatin (200-500 bp fragments)

    • Immunoprecipitate using anti-SPAC31G5.07 antibodies or antibodies against epitope tags

  • Controls and Validation:

    • Use IgG or non-specific antibody as negative control

    • Include input DNA control

    • Perform qPCR validation of enriched regions before sequencing

    • Include wild-type vs. deletion strain comparisons

  • Data Analysis Pipeline:

    • Align reads to S. pombe genome

    • Peak calling using MACS2 or similar software

    • Motif analysis of enriched regions

    • Integration with transcriptome data

    • Gene ontology analysis of associated genes

  • Technical Considerations:

    • Optimize cross-linking conditions for membrane proteins

    • Consider using proximity-based methods like ChIP-exo for higher resolution

    • Validate findings with orthogonal methods (e.g., DNA pull-down assays) .

What strategies are recommended for investigating potential interactions between SPAC31G5.07 and other membrane proteins?

To investigate interactions between SPAC31G5.07 and other membrane proteins:

  • In vivo Approaches:

    • Bimolecular Fluorescence Complementation (BiFC)

    • Förster Resonance Energy Transfer (FRET)

    • Proximity Ligation Assay (PLA)

    • Split-ubiquitin yeast two-hybrid system (specifically designed for membrane proteins)

  • Biochemical Methods:

    • Co-immunoprecipitation with mild detergents

    • Crosslinking followed by mass spectrometry

    • Blue native PAGE for membrane protein complexes

  • Experimental Design Considerations:

    • Use appropriate controls (non-interacting membrane proteins)

    • Test interactions under different physiological conditions

    • Consider the topology of the membrane proteins

    • Validate interactions using multiple methods

  • Advanced Proteomics Strategy:

    • SILAC or TMT labeling for quantitative interaction analysis

    • Data-independent acquisition (DIA) mass spectrometry

    • Crosslinking mass spectrometry (XL-MS) for structural interface mapping

  • Candidate Interaction Partners:

    • Focus on proteins co-expressed during nitrogen starvation

    • Consider proteins involved in cell fusion processes

    • Examine proteins in the same subcellular compartment .

What are the common pitfalls in SPAC31G5.07 deletion studies and how can they be addressed?

Common pitfalls in SPAC31G5.07 deletion studies include:

  • Revival Difficulties: Historical data from Bioneer deletion libraries indicates that SPAC31G5.07 deletion strains could not be initially revived.

    • Solution: Use freshly replaced strains from Bioneer or create new deletions with careful verification.

  • PCR Verification Issues: Non-specific amplification.

    • Solution: Design primers at least 200 bp upstream and downstream of deletion junctions. Use longer extension times and touchdown PCR protocols.

  • Phenotype Subtlety: Lack of obvious phenotypes under standard growth conditions.

    • Solution: Test multiple conditions, especially nitrogen starvation, pheromone exposure, and mating conditions.

  • Genetic Background Effects: Phenotypic variability in different strain backgrounds.

    • Solution: Create deletions in multiple standard laboratory strains and compare results.

  • Complementation Challenges: Difficulty in distinguishing partial from complete complementation.

    • Solution: Use quantitative assays and include positive and negative controls.

  • Cross-Contamination: Confusion with similarly named genes.

    • Solution: Thoroughly verify all strains by sequencing and PCR before experiments .

How should researchers address contradictory functional data when characterizing SPAC31G5.07?

When faced with contradictory functional data for SPAC31G5.07:

  • Systematic Validation Protocol:

    • Verify strain identity (sequencing, PCR verification)

    • Confirm epitope tags haven't affected protein function

    • Check for suppressors or secondary mutations

    • Rule out experimental artifacts through independent methods

  • Experimental Design Improvements:

    • Increase biological and technical replicates

    • Implement more stringent statistical analysis

    • Use multiple methods to assess the same function

    • Consider environmental variables (media composition, temperature)

  • Reconciliation Strategies:

    • Context-dependent function (different conditions yield different results)

    • Redundancy (other proteins may compensate for loss in some backgrounds)

    • Threshold effects (quantitative rather than qualitative differences)

    • Epistatic relationships (genetic background influences phenotype)

  • Documentation and Reporting:

    • Maintain detailed lab records of all experimental conditions

    • Report contradictory results in publications

    • Clearly specify experimental conditions that led to different outcomes

    • Collaborate with other labs to independently verify results .

How conserved is SPAC31G5.07 across species and what can orthology tell us about its function?

SPAC31G5.07/dni1 shows limited conservation across species:

  • Orthology Distribution:

    • Present in Schizosaccharomyces species

    • Limited or no clear orthologs in more distant fungi

    • No identified orthologs in higher eukaryotes

  • Evolutionary Implications:

    • Likely represents a fungal-specific adaptation

    • May be involved in cell fusion processes specific to fission yeast mating

    • The limited conservation suggests specialized rather than fundamental cellular functions

  • Domain Conservation Analysis:

    • Transmembrane domains show higher conservation than other regions

    • Potential functional motifs can be identified through multiple sequence alignment

    • Analysis of selection pressure (dN/dS ratios) can identify functionally constrained regions

  • Functional Prediction Based on Orthologs:

    • Even distant homologs with characterized functions can provide functional clues

    • Search for proteins with similar domain architecture in other species

    • Use HCOP (HGNC Comparison of Orthology Predictions) and similar tools to identify potential functional analogs .

What insights can be gained by comparing SPAC31G5.07 with other membrane proteins involved in cell fusion?

Comparative analysis with other cell fusion membrane proteins provides valuable insights:

  • Structural Comparison:

    • Identify common motifs or domains shared with characterized fusion proteins

    • Analyze transmembrane topology patterns

    • Compare hydrophobicity profiles and potential lipid interaction sites

  • Functional Context:

    • Examine expression patterns during mating and fusion events

    • Analyze co-expression networks with known fusion proteins

    • Compare phenotypes of deletion mutants

  • Regulatory Patterns:

    • Compare promoter elements and transcription factor binding sites

    • Analyze post-translational modifications

    • Examine protein turnover rates during fusion events

  • Comparative Table Example:

ProteinSpeciesFunctionExpression PatternPhenotype of DeletionLocalizationInteraction Partners
SPAC31G5.07 (dni1)S. pombeCell fusionInduced by N starvationRevival difficulty in deletion libraryMembrane[To be determined]
Fus1S. pombeCell fusionMating-specificDefective cell fusionCell tips during matingFormin, actin
Prm1S. cerevisiaeMembrane fusionMating-specificDefective membrane fusionCell fusion junctionFig1
HAP2/GCS1Plants, algaeGamete fusionGamete-specificSterileGamete membrane[Various]
  • Evolutionary Trajectory Analysis:

    • Reconstruct the evolutionary history of fusion proteins

    • Identify gene duplication or loss events

    • Map functional innovations to phylogenetic branches .

What are the optimal approaches for visualizing SPAC31G5.07 localization and dynamics in living cells?

For optimal visualization of SPAC31G5.07 localization and dynamics:

  • Fluorescent Protein Tagging Strategies:

    • C-terminal tagging is preferred to avoid disrupting potential N-terminal signal sequences

    • Use monomeric fluorescent proteins (mNeonGreen or mScarlet) for bright signals

    • Consider photoconvertible fluorophores (mEos3.2) for pulse-chase experiments

    • Employ split fluorescent proteins for detecting protein interactions

  • Live-Cell Imaging Optimization:

    • Use minimal phototoxicity settings (reduced laser power, sensitive cameras)

    • Add antioxidants to imaging media to reduce photodamage

    • Apply deconvolution algorithms to improve signal-to-noise ratio

    • Implement adaptive illumination strategies

  • Advanced Microscopy Techniques:

    • Super-resolution approaches (SIM, PALM/STORM) for detailed localization

    • Single-particle tracking for dynamic analysis

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

    • TIRF microscopy for visualizing events near the cell membrane

  • Experimental Controls and Validation:

    • Confirm functionality of tagged protein by complementation tests

    • Use multiple tagging strategies to rule out tag-specific artifacts

    • Include markers for cellular compartments

    • Validate with immunofluorescence using specific antibodies

  • Quantitative Analysis Framework:

    • Develop custom image analysis pipelines for S. pombe cells

    • Track protein redistribution during cell cycle or nitrogen starvation

    • Measure colocalization with other proteins

    • Quantify changes in protein dynamics under different conditions .

What structural characterization methods would be most informative for an uncharacterized membrane protein like SPAC31G5.07?

For structural characterization of SPAC31G5.07:

How should researchers integrate multi-omics data to understand SPAC31G5.07 function in cellular context?

To integrate multi-omics data for understanding SPAC31G5.07 function:

  • Data Collection and Integration Strategy:

    • Generate or collect transcriptomics, proteomics, metabolomics, and phenomics data

    • Establish a unified data processing pipeline with consistent normalization

    • Apply dimensionality reduction techniques (PCA, t-SNE) for data visualization

    • Use correlation networks to identify functional associations

  • Integration Approaches:

    • Weighted correlation network analysis (WGCNA) to identify modules

    • Bayesian network modeling to infer causal relationships

    • Machine learning for pattern recognition across datasets

    • Knowledge-based integration using existing pathway information

  • Functional Context Mapping:

    • Map SPAC31G5.07-associated changes to cellular pathways

    • Identify co-regulated genes across conditions

    • Compare with known membrane protein networks

    • Detect condition-specific interaction patterns

  • Visualization and Interpretation:

    • Develop interactive visualization tools for exploring relationships

    • Create integrated pathway maps highlighting SPAC31G5.07 connections

    • Implement temporal analysis to identify early vs. late responses

    • Use comparative analysis across mutants to identify specific effects

  • Validation of Integrated Models:

    • Design targeted experiments to test predicted interactions

    • Use CRISPR-based perturbations to verify network connections

    • Apply orthogonal techniques to confirm key findings

    • Perform cross-validation across independent datasets .

What statistical approaches are most appropriate for analyzing phenotypic data from SPAC31G5.07 mutant studies?

For statistical analysis of SPAC31G5.07 mutant phenotypic data:

  • Experimental Design Considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomized block design to control for batch effects

    • Inclusion of appropriate controls (wild-type, known phenotype mutants)

    • Factorial designs to test interaction effects between conditions

  • Appropriate Statistical Methods:

    • For continuous data: ANOVA, linear mixed models, t-tests with correction

    • For categorical data: Chi-square, Fisher's exact test, logistic regression

    • For time-course data: Repeated measures ANOVA, functional data analysis

    • For high-dimensional data: Multivariate analysis, machine learning approaches

  • Multiple Testing Correction:

    • Bonferroni correction for strong control of family-wise error rate

    • Benjamini-Hochberg procedure for false discovery rate control

    • Permutation-based methods for empirical p-value estimation

    • Sequential testing procedures for staged hypothesis testing

  • Advanced Analytical Approaches:

    • Survival analysis for time-to-event data

    • Bayesian hierarchical models for integrating prior knowledge

    • Causal inference methods to distinguish direct from indirect effects

    • Meta-analysis techniques for combining results across experiments

  • Reporting and Visualization:

    • Include effect sizes and confidence intervals, not just p-values

    • Use appropriate graphics (violin plots, boxplots with individual points)

    • Report all statistical tests performed, including negative results

    • Provide raw data and analysis code for reproducibility .

How can CRISPR-Cas9 technology be optimized for studying SPAC31G5.07 function in S. pombe?

Optimizing CRISPR-Cas9 for studying SPAC31G5.07 in S. pombe:

  • CRISPR System Adaptation for S. pombe:

    • Use codon-optimized Cas9 for efficient expression

    • Express sgRNAs from RNA polymerase III promoters (e.g., U6)

    • Optimize tracrRNA and crRNA designs for S. pombe

    • Consider using Cas9 variants with improved specificity

  • Target Selection and Design:

    • Choose target sites with minimal off-target potential

    • Design multiple sgRNAs targeting different regions of SPAC31G5.07

    • Consider PAM site availability in AT-rich regions

    • Use S. pombe-specific sgRNA design tools to account for genome peculiarities

  • Advanced Genome Engineering Applications:

    • Base editing for introducing point mutations without DSBs

    • Prime editing for precise insertions or deletions

    • CRISPRi for transcriptional repression studies

    • CRISPRa for overexpression analysis

  • Delivery and Selection Strategies:

    • Optimize transformation protocols for CRISPR components

    • Use antibiotic selection markers for identifying transformants

    • Employ ribonucleoprotein (RNP) delivery for transient editing

    • Consider inducible Cas9 expression to minimize toxicity

  • Validation and Analysis:

    • Implement deep sequencing to detect editing efficiency

    • Use control sgRNAs targeting non-essential genes

    • Check for off-target effects with whole-genome sequencing

    • Verify phenotypes with complementation tests

  • Experimental Design Example:

Experimental ApproachsgRNA Target LocationRepair TemplateExpected OutcomeControl
Gene knockoutCoding sequence startNone (NHEJ)Frameshift and loss-of-functionNon-targeting sgRNA
Domain deletionSpecific domain boundariesHomology-directed repairIn-frame deletion of specific domainWild-type repair template
Tag insertionC-terminusHomology-directed repair with tagEndogenous taggingUntagged control
Point mutationPredicted functional residueHomology-directed repair with mutationSpecific functional effectWild-type repair template
  • Future Applications:

    • Multiplex editing to study genetic interactions

    • Saturation mutagenesis for comprehensive functional analysis

    • Pooled CRISPR screens under nitrogen starvation conditions

    • Temporal control of editing using optogenetics or chemical induction .

What future research directions might reveal the most about SPAC31G5.07's cellular functions?

Promising future research directions for SPAC31G5.07 include:

  • Comprehensive Protein Interaction Mapping:

    • BioID or APEX2 proximity labeling to identify membrane-proximal interactors

    • Split-ubiquitin membrane yeast two-hybrid screening

    • Systematic genetic interaction mapping (synthetic genetic array)

    • Quantitative interactome analysis under multiple conditions

  • Single-Cell Analysis:

    • Single-cell transcriptomics during nitrogen starvation response

    • High-throughput microscopy with machine learning image analysis

    • Single-cell proteomics to detect cell-to-cell variability

    • Microfluidics-based assays for dynamic responses

  • Structural and Functional Dissection:

    • Cryogenic electron microscopy for high-resolution structure

    • Single-molecule biophysics to examine conformational changes

    • In vitro reconstitution of membrane fusion activities

    • Domain-specific functional assays

  • Context-Dependent Regulation:

    • Systematic analysis across stress conditions beyond nitrogen starvation

    • Investigation of post-translational modifications

    • Lipid interaction profiling

    • Temporal dynamics during mating and sporulation

  • Systems-Level Integration:

    • Construction of predictive models of cell fusion machinery

    • Integration with global cellular response networks

    • Comparative analysis across yeast species

    • Multi-scale modeling from molecular to cellular levels

  • Translational Relevance:

    • Exploration of analogous processes in higher eukaryotes

    • Investigation of potential roles in fungal pathogenesis

    • Application of insights to synthetic biology applications

    • Development of tools for membrane protein functional analysis

  • Research Roadmap:

PhaseTimelineKey QuestionsApproachesExpected Outcomes
IYear 1Localization and expressionFluorescent tagging, proteomicsSpatial and temporal context
IIYears 1-2Interaction partnersBioID, co-IP, genetic interactionsFunctional network
IIIYears 2-3Structure-function relationshipsMutagenesis, structural analysisMechanistic insights
IVYears 3-4Systems integrationMulti-omics, mathematical modelingContextual understanding
VYears 4-5Translational applicationsComparative biology, synthetic systemsBroader relevance
  • Technological Innovations:

    • Application of emerging spatial transcriptomics to S. pombe

    • Development of S. pombe-specific organoid or spheroid systems

    • Advanced genome engineering beyond basic CRISPR applications

    • Novel membrane protein structural analysis methods .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.