Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C338.18 (SPCC338.18)

What is known about the structure and function of the Uncharacterized membrane protein C338.18?

The Uncharacterized membrane protein C338.18 (SPCC338.18) from Schizosaccharomyces pombe is a 117-amino acid protein with the UniProt accession number O74992. Its amino acid sequence (MTEQNIDIKRELKDESPIGQSPHLENDGRPSLMSRYSYSSIEEVSKEGYQWFKHQSVFLKFSLIVLLFSLMFSLTFGSLLGLISLALGFPSVGYRYVLLPILNALLNRLRLNSSGLK) suggests it contains hydrophobic regions characteristic of transmembrane domains. Based on structural predictions, it likely contains multiple membrane-spanning regions that anchor it within the cellular membrane . As with many membrane proteins, it may function as a transporter, receptor, or signaling molecule, though its specific role remains to be elucidated through targeted research approaches. Sequence analysis indicates potential structural motifs that may provide clues to its biological function in fission yeast.

Why is Schizosaccharomyces pombe used as a model organism for studying this membrane protein?

Schizosaccharomyces pombe (fission yeast) serves as an excellent model organism for studying membrane proteins for several compelling reasons. As a unicellular eukaryote with a fully sequenced genome, S. pombe offers significant experimental advantages while maintaining core cellular processes conserved in higher eukaryotes. The organism's relatively simple membrane architecture, compared to mammalian cells, facilitates isolation and characterization of membrane proteins while preserving relevant biological context . Additionally, S. pombe's genetic tractability enables efficient gene manipulation through homologous recombination, allowing researchers to introduce mutations, deletions, or epitope tags to study protein function. The well-established tools for culturing, transforming, and analyzing S. pombe make it particularly suitable for investigating fundamental aspects of membrane protein biology that may translate to more complex eukaryotic systems.

What expression systems are recommended for producing recombinant SPCC338.18 protein?

For recombinant expression of SPCC338.18, several expression systems can be employed based on experimental requirements. Bacterial systems (particularly E. coli) offer cost-effective, high-yield production but may present challenges with membrane protein folding and post-translational modifications. For this specific protein, expression in yeast systems (S. cerevisiae or native S. pombe) often provides superior results due to appropriate eukaryotic processing machinery and membrane insertion mechanisms .

Mammalian expression systems (HEK293 or CHO cells) may be warranted for functional studies requiring mammalian-specific post-translational modifications. When designing expression constructs, consider incorporating:

• Purification tags (His6, FLAG, or GST) at either terminus (though C-terminal tagging is preferred to avoid interfering with potential signal sequences)

• Codon optimization for the chosen expression host

• Inducible promoters for controlled expression

• Fusion partners that enhance solubility or membrane integration

The selection of an appropriate expression system should be guided by the specific research objectives, whether structural analysis, functional characterization, or interaction studies.

What are the optimal storage conditions for maintaining SPCC338.18 protein stability?

To maintain optimal stability of the recombinant SPCC338.18 protein, storage at -20°C is recommended for routine use, while long-term storage is best at -80°C. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized to prevent protein degradation and maintain native conformation . Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of biological activity. For working solutions, aliquots can be maintained at 4°C for up to one week. When handling the protein, minimize exposure to extreme pH conditions, proteases, and oxidizing agents that may compromise structural integrity. If resuspension or buffer exchange is necessary, use buffers containing appropriate detergents (such as DDM, CHAPS, or digitonin) at concentrations above their critical micelle concentration to maintain the protein in a solubilized state.

What mass spectrometry techniques are most effective for analyzing the topology and post-translational modifications of SPCC338.18?

For comprehensive topological analysis of SPCC338.18, several complementary mass spectrometry (MS) approaches can be employed. Hydrogen/deuterium exchange mass spectrometry (H/D-MS) represents a powerful technique for determining transmembrane regions by measuring the differential rates of hydrogen exchange across the protein structure . Accessible regions exchange rapidly while membrane-embedded segments show significantly reduced exchange rates, providing valuable insights into protein topology.

Chemical labeling approaches offer higher resolution for specific amino acid residues. Hydroxyl radical (- OH) labeling, which preferentially modifies methionine residues, can serve as precise conformational probes when strategically introduced into the protein sequence . Similarly, DiPC (diisopropylcarbodiimide) tagging targets aspartic and glutamic acid residues, providing detailed information about charged residue accessibility .

For post-translational modification (PTM) analysis, a multi-faceted approach is recommended:

Enrichment strategies such as titanium dioxide chromatography for phosphorylation or lectin affinity for glycosylation should be implemented prior to MS analysis to enhance detection sensitivity. When analyzing membrane proteins like SPCC338.18, incorporating appropriate detergents during sample preparation is crucial, with MS-compatible options such as RapiGest, ProteaseMAX, or sodium deoxycholate recommended to maintain protein solubility without interfering with subsequent MS analysis .

How can protein-protein interaction networks involving SPCC338.18 be effectively mapped?

Mapping protein-protein interaction networks for membrane proteins like SPCC338.18 requires specialized approaches that account for their hydrophobic nature and native membrane environment. A multi-tiered strategy is recommended for comprehensive interaction mapping:

Proximity-based labeling techniques such as BioID or APEX2 fusion proteins can identify neighboring proteins in their native cellular context without requiring strong physical interactions. By generating the SPCC338.18 protein fused to a promiscuous biotin ligase, proteins in close proximity become biotinylated and can subsequently be isolated and identified by mass spectrometry .

Affinity purification coupled with mass spectrometry (AP-MS) using epitope-tagged SPCC338.18 can identify stable interaction partners. When implementing this approach, consider:

• Using multiple purification tags (FLAG, HA, or His) to validate interactions

• Employing mild detergents (digitonin, DDM) to preserve native interactions

• Including appropriate controls (tag-only, unrelated membrane protein)

• Performing quantitative MS with isotopic labeling (SILAC or TMT) to distinguish specific from non-specific interactions

For direct binary interactions, the split-ubiquitin membrane yeast two-hybrid system specifically designed for membrane proteins offers advantages over conventional yeast two-hybrid methods. This technique allows for the screening of interaction partners while the protein remains in its membrane context.

Crosslinking mass spectrometry (XL-MS) using membrane-permeable crosslinkers can provide detailed spatial information about interaction interfaces. Modern MS techniques can now analyze intact membrane protein complexes directly in the mass spectrometer through "top-down native MS," preserving non-covalent interactions during analysis .

Data integration from multiple methodologies using computational network analysis will provide the most complete and reliable interaction map for SPCC338.18.

What techniques can determine the subcellular localization and trafficking dynamics of SPCC338.18?

Determining the subcellular localization and trafficking dynamics of SPCC338.18 requires a combination of imaging, biochemical, and genetic approaches. For visualization of the native protein, developing specific antibodies against SPCC338.18 enables immunofluorescence microscopy. Alternatively, generating fluorescently tagged versions (GFP, mCherry) of the protein allows for live-cell imaging, though care must be taken to verify that tagging does not interfere with localization or function.

For dynamic localization studies, photoactivatable or photoconvertible fluorescent proteins (PA-GFP, mEos) fused to SPCC338.18 enable pulse-chase imaging to track protein movement through cellular compartments. Fluorescence recovery after photobleaching (FRAP) provides quantitative measurements of protein mobility within membranes, while single-particle tracking can reveal detailed movements at the molecular level.

Biochemical fractionation coupled with western blotting or mass spectrometry offers complementary evidence for localization. Sequential extraction of different membrane compartments using differential centrifugation and density gradients can isolate plasma membrane, endoplasmic reticulum, Golgi, and other organelle fractions for protein detection .

For trafficking studies, temperature-sensitive mutants that block specific trafficking steps or pharmacological inhibitors of vesicular transport pathways can trap SPCC338.18 at distinct stages of its trafficking itinerary. Quantitative proteomics comparing protein abundance in different cellular fractions under various conditions can reveal trafficking dynamics in response to cellular stimuli or during different growth phases.

Genetic approaches, including systematic screening of trafficking mutants in S. pombe, can identify factors required for proper SPCC338.18 localization, providing insights into its trafficking machinery and regulatory mechanisms.

What structural prediction algorithms are most suitable for generating models of SPCC338.18's transmembrane domains?

For structural prediction of SPCC338.18's transmembrane domains, several algorithms have demonstrated particular efficacy for membrane proteins. Modern approaches combine different computational methods to overcome limitations of individual techniques:

A recommended workflow would begin with transmembrane topology prediction using TMHMM and TOPCONS to identify membrane-spanning regions, followed by secondary structure prediction with PSIPRED. For tertiary structure modeling, AlphaFold2 has revolutionized prediction accuracy for membrane proteins. The resulting models should be validated using ProCheck or MolProbity to assess stereochemical quality.

For optimal results, structural predictions should be constrained by experimental data when available, such as distance constraints from crosslinking experiments, accessibility data from chemical labeling, or topology information from protease protection assays . The integration of computational predictions with even limited experimental data significantly enhances model reliability.

What are the most effective solubilization and purification strategies for SPCC338.18?

Efficient solubilization and purification of SPCC338.18 requires careful optimization to maintain protein stability and functionality. For membrane extraction, a systematic screening of detergents is recommended, starting with mild non-ionic detergents such as DDM, LMNG, or digitonin that preserve protein-protein interactions and functional integrity. The critical solubilization parameters include:

• Detergent concentration: Typically 1-2% for extraction, reduced to just above CMC for purification

• Buffer composition: 20-50 mM Tris or phosphate buffer with 100-300 mM NaCl

• pH optimization: Usually 7.0-8.0 for initial extraction

• Temperature: 4°C for most steps to minimize degradation

• Addition of stabilizers: Glycerol (10-20%), cholesterol hemisuccinate, or specific lipids

For purification, affinity chromatography using N- or C-terminal tags (His6, FLAG, or Strep-tag II) provides an effective first step. When using polyhistidine tags, consider using TALON or NiNTA resins with imidazole gradients for elution to minimize non-specific binding. Size exclusion chromatography (SEC) serves as an excellent polishing step and simultaneously assesses protein homogeneity and oligomeric state .

Alternative solubilization approaches include:

• Styrene maleic acid lipid particles (SMALPs) that extract membrane proteins with their native lipid environment

• Amphipols for detergent-free handling after initial solubilization

• Nanodiscs for reconstitution into defined lipid bilayers after purification

Quality control at each step is essential, incorporating techniques such as SDS-PAGE, western blotting, mass spectrometry, and dynamic light scattering to assess purity, identity, and homogeneity. For functional validation, consider developing activity assays based on predicted functions or binding studies using potential interaction partners.

How can researchers effectively design CRISPR/Cas9 strategies for modifying or deleting SPCC338.18 in S. pombe?

Designing effective CRISPR/Cas9 strategies for SPCC338.18 modification in S. pombe requires careful consideration of several technical aspects. The process begins with thorough guide RNA (gRNA) design, selecting target sequences with minimal off-target potential while maintaining high on-target efficiency. For S. pombe genome editing, the following parameters are particularly important:

• Select 19-20 nucleotide target sequences adjacent to NGG PAM sites

• Avoid sequences with high GC content (>80%) or long homopolymer stretches

• Perform comprehensive off-target analysis using algorithms optimized for S. pombe genome

• Design gRNAs targeting the 5' region of the gene for knockouts or specific domains for functional studies

For expression, RNA polymerase III promoters such as U6 work efficiently in S. pombe. When constructing repair templates for precise editing:

• For gene deletion: Design homology arms of 500-1000 bp flanking the target site

• For point mutations: Include 50-80 bp homology on each side of the edit site with the mutation centrally positioned

• For protein tagging: Place tags at the C-terminus when possible to avoid disrupting signal sequences

Delivery options include plasmid-based systems or ribonucleoprotein (RNP) complexes of purified Cas9 and synthetic gRNA, with the latter often providing higher efficiency and reduced off-target effects. Post-transformation, implement efficient screening strategies using:

• Antibiotic selection markers flanked by loxP sites for subsequent marker removal

• Junction PCR to verify correct integration

• Sanger sequencing to confirm precise edits

• Western blotting to verify protein modification or absence

For membrane proteins like SPCC338.18, consider generating conditional alleles (temperature-sensitive or auxin-inducible degron tags) as complete deletion may be lethal if the protein serves essential functions.

What are the optimal conditions for conducting functional assays with recombinant SPCC338.18?

Conducting functional assays with recombinant SPCC338.18 requires careful optimization of experimental conditions to maintain protein activity and native conformation. Based on its predicted membrane localization, functional characterization should focus on potential roles in transport, signaling, or protein-protein interactions. The following parameters should be systematically optimized:

Buffer composition should include:

• pH range screening (typically pH 6.5-8.0)

• Ionic strength variation (100-300 mM salt)

• Divalent cation requirements (1-10 mM Mg²⁺ or Ca²⁺)

• Reducing agent presence (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

Membrane mimetics are critical for maintaining functionality:

• Detergent micelles (DDM, LMNG, or digitonin)

• Reconstitution into proteoliposomes using S. pombe lipid extracts

• Nanodiscs with defined lipid composition

• Supported lipid bilayers for surface-based assays

Temperature conditions should reflect physiological relevance:

• Standard assays at 30°C (optimal S. pombe growth temperature)

• Temperature stability profiles from 4-37°C for thermostability assessment

For specific functional hypotheses, consider these targeted assays:

• Transport activity: Measure substrate flux across proteoliposomes using fluorescent substrates or radiolabeled compounds

• Binding studies: Surface plasmon resonance (SPR) or microscale thermophoresis (MST) to quantify interactions with potential binding partners

• Structural changes: Circular dichroism (CD) spectroscopy to monitor conformational changes upon substrate binding

• Enzyme activity: If predicted to have enzymatic function, develop specific activity assays based on bioinformatic predictions

Complementary genetic approaches can provide additional functional insights:

• Phenotypic analysis of deletion or conditional mutants

• Genetic interaction mapping through synthetic genetic arrays

• Multicopy suppressor screens to identify functional partners

• Heterologous expression in mammalian cells to assess conservation of function

These approaches should be implemented with appropriate controls, including protein variants with predicted inactivating mutations, to validate assay specificity.

How can researchers analyze the evolutionary conservation and divergence of SPCC338.18 across fungal species?

Analysis of evolutionary conservation and divergence of SPCC338.18 across fungal species provides valuable insights into functional importance, structural constraints, and potential species-specific adaptations. A comprehensive evolutionary analysis should incorporate multiple computational approaches and comparative genomics techniques.

For sequence-based phylogenetic analysis:

• Perform BLAST searches against fungal genome databases, including ascomycetes, basidiomycetes, and early-diverging fungi

• Construct multiple sequence alignments using MUSCLE, MAFFT, or T-Coffee algorithms optimized for transmembrane proteins

• Generate phylogenetic trees using maximum likelihood (RAxML, IQ-TREE) or Bayesian inference (MrBayes) methods

• Calculate sequence conservation scores using ConSurf or Rate4Site, mapping conservation onto predicted structural models

For comparative genomic analysis:

• Examine gene neighborhood conservation (synteny) across closely related species

• Identify co-evolving genes that maintain genomic proximity or phylogenetic profiles

• Compare gene copy number variations across fungal lineages

• Analyze presence/absence patterns in relation to ecological niches and metabolic capabilities

For structure-based evolutionary analysis:

• Identify conservation patterns within predicted transmembrane domains versus loop regions

• Apply codon-based selection analyses (PAML, HyPhy) to detect positive or negative selection

• Analyze co-evolution between amino acid residues using mutual information or direct coupling analysis

• Predict functional sites based on evolutionary conservation patterns

The resulting evolutionary profile can be visualized as a heat map showing sequence identity across species:

These analyses collectively provide a framework for understanding the protein's evolutionary history, identifying functionally critical regions, and guiding experimental design for functional characterization.

What are the current knowledge gaps and future research directions for SPCC338.18?

Despite advances in membrane protein analysis techniques, significant knowledge gaps remain regarding SPCC338.18. The primary challenge lies in establishing its precise biological function, as it remains classified as "uncharacterized" despite its conservation in fungi. Future research should prioritize:

• Comprehensive phenotypic characterization of deletion/conditional mutants under various stress conditions to identify functional roles

• Interactome mapping using complementary approaches to identify protein complexes and pathways involving SPCC338.18

• Structural determination using cryo-electron microscopy or X-ray crystallography, potentially facilitated by the recent advances in membrane protein structural biology

• Development of activity assays based on refined functional hypotheses derived from evolutionary analysis and structural predictions

• Investigation of potential roles in membrane organization, transport, or signaling pathways specific to fission yeast biology

The integration of cutting-edge technologies, particularly in mass spectrometry and structural biology, stands to significantly accelerate our understanding of this protein . Advances in hydrogen/deuterium exchange mass spectrometry, chemical labeling approaches coupled with MS, and phospholipid bilayer nanodiscs with H/D-MS offer promising avenues for elucidating the protein's topology and dynamic conformational changes .

Ultimately, unraveling the function of SPCC338.18 may provide insights not only into S. pombe membrane biology but also into conserved membrane protein functions across eukaryotes. This research has potential implications for understanding fundamental cellular processes and possibly identifying novel therapeutic targets in pathogenic fungi.

How can researchers contribute to the community knowledge base about SPCC338.18?

Researchers investigating SPCC338.18 can make significant contributions to the scientific community by adhering to best practices in data generation, analysis, and sharing. To maximize the impact of research findings:

• Deposit all sequence data, structural models, and mass spectrometry datasets in appropriate public repositories (UniProt, PDB, ProteomeXchange) with detailed metadata

• Contribute functional annotations to the PomBase database, the primary repository for S. pombe genetic and protein information

• Standardize experimental protocols and share detailed methodologies through protocols.io or similar platforms

• Develop and share research tools such as antibodies, expression constructs, or mutant strains through repositories like Addgene or the Yeast Genetic Resource Center

• Establish collaborations across disciplines to bring complementary expertise to bear on challenging aspects of membrane protein biology

When publishing findings, consider using the preprint ecosystem (bioRxiv, arXiv) to accelerate dissemination while maintaining rigorous peer review through traditional journals. Open science practices, including sharing raw data and analysis code, enhance reproducibility and accelerate discovery in this emerging field.