Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C569.06 (SPCC569.06)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPCC569.06; Uncharacterized membrane protein C569.06
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-478
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC569.06
Target Protein Sequence
SSVEGAIEKVPQSLEQKGPSEMLSMKPDVKGGFGDRMMFIPFQSDLGLHSPVDRSGFEYC GYLDAIESEDGDSSRAPYAKLQLKENVEGIARFGLFYHPSPFQAFKHIIDNGGKYSGLDR VFLENLRKSLVVSLDSAVNRTYSIPVEDEGFYCFVGYQEVAHQETVIGENSEPIVTIEFD SFNSNVPVTLKLQRQIFLSFSIVYGLISLWWAIRCICSRTKLHLVQVCLFCWFSFFILNH PVKQRIFSIDNPDEYLVPFVVSCFTYFLGDGIEYALYSLFITTTVLGFGTIRRTSKKMVL FFSLLTCGQAFLVNVAPMVYPLLYISGSDKACVLRMVWVFNKFLYLPLITFLGAVLAFRF RLKKASQFDTRWNLFALTLAIIILFAFNDLVIFDKLQKLWKYDDTTLEYLKIVNGGIKFV AFSILLGPYSKLFAEPKSLQLDDFLGKHDGHKDPSLEKF
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of SPCC569.06 in S. pombe?

SPCC569.06 is located on chromosome 3 of S. pombe, in a region that has been identified in heterochromatin formation studies. Research indicates that neighboring genes in this region, including puf6 and SPCC569.03, can accumulate H3K9me marks and Swi6 protein under certain conditions, suggesting this genomic region may be subject to epigenetic regulation . When designing experiments to study this protein, researchers should consider this chromosomal context, as epigenetic silencing could affect expression levels depending on experimental conditions.

What expression systems are most suitable for recombinant production of SPCC569.06?

For recombinant expression of SPCC569.06, endogenous S. pombe expression systems are preferred due to the protein's native context. The pREP series of vectors with thiamine-repressible promoters of varying strengths (nmt1, nmt41, nmt81) offer controlled expression levels. For membrane proteins like SPCC569.06, moderate expression levels (nmt41 or nmt81 promoters) often yield better results by preventing aggregation. Homologous expression ensures proper post-translational modifications, particularly appropriate glycosylation patterns that are critical for membrane protein function and stability .

How do I optimize spheroplasting protocols for SPCC569.06 extraction?

Effective spheroplasting is critical when working with membrane proteins like SPCC569.06. The standard protocol involves:

  • Grow S. pombe cells to mid-log phase (OD600 = 0.5-0.8)

  • Harvest cells by centrifugation (3,000 × g for 5 minutes)

  • Wash with spheroplasting buffer (1.2 M sorbitol, 50 mM sodium citrate, pH 5.8)

  • Resuspend in spheroplasting buffer containing 1 mg/ml Zymolyase-100T

  • Incubate at 30°C with gentle shaking, monitoring spheroplast formation microscopically

For membrane proteins specifically, add protease inhibitors (1 mM PMSF, EDTA-free protease inhibitor cocktail) throughout the process to prevent degradation. The spheroplasting efficiency can be monitored by measuring OD600 reduction in the presence of 1% SDS .

What genetic approaches can I use to study SPCC569.06 function?

To study the function of the uncharacterized SPCC569.06 protein, several genetic approaches can be implemented:

  • Gene deletion: Create a SPCC569.06Δ strain using PCR-based gene targeting with antibiotic resistance markers (kanMX6, natMX6, or hphMX6). Phenotypic analysis of the deletion strain can provide initial insights into protein function.

  • Conditional expression systems: For essential genes, use the nmt1 promoter system with thiamine regulation to create conditional mutants.

  • Epitope tagging: C-terminal or N-terminal tagging with GFP, RFP, or small epitopes (HA, myc, FLAG) for localization and interaction studies.

  • Suppressor screens: If SPCC569.06Δ shows a detectable phenotype, conduct suppressor screens to identify interacting genes. This approach has been successfully used to characterize various S. pombe proteins, including identification of multicopy suppressors like sup11+ .

  • Haploinsufficiency assays: Create heterozygous diploid strains to assess gene dosage effects, which can be particularly informative for proteins involved in cell wall integrity, membrane maintenance, or transport functions .

How can I differentiate between direct and indirect effects in SPCC569.06 mutant phenotypes?

Distinguishing direct from indirect effects in SPCC569.06 mutant phenotypes requires multiple complementary approaches:

  • Acute inactivation systems: Use temperature-sensitive alleles or auxin-inducible degron systems to rapidly inactivate the protein, minimizing secondary effects.

  • Domain-specific mutations: Rather than complete deletion, introduce mutations in specific functional domains of SPCC569.06 to connect particular protein regions to specific phenotypes.

  • Epistasis analysis: Construct double mutants with genes in suspected related pathways to establish hierarchical relationships. For example, if SPCC569.06 is suspected to be involved in heterochromatin formation, create double mutants with clr4Δ, swi6Δ, or epe1Δ as demonstrated in similar studies .

  • Transcriptome analysis: Compare gene expression profiles between wildtype and mutant strains immediately after protein inactivation versus long-term adaptation. Acute response genes are more likely to be direct targets.

  • Complementation testing: Reintroduce wildtype SPCC569.06 or specific mutated variants to validate phenotype rescue capabilities.

What methods are most effective for visualizing SPCC569.06 subcellular localization?

For optimal visualization of SPCC569.06 subcellular localization in S. pombe:

  • Genomic fluorescent protein tagging: Tag the endogenous SPCC569.06 gene with mNeonGreen or mScarlet using PCR-based methods. These fluorophores provide superior brightness and photostability compared to traditional GFP/RFP in S. pombe.

  • Co-localization analysis: Combine SPCC569.06 tagging with established organelle markers: Anp1-mCherry (Golgi), Sec72-tdTomato (ER), Cox4-RFP (mitochondria), or Can1-GFP (plasma membrane) to precisely identify membrane compartment localization.

  • Super-resolution microscopy: For detailed membrane protein arrangement, apply techniques like structured illumination microscopy (SIM) or photoactivated localization microscopy (PALM).

  • Endosome tracking: If SPCC569.06 undergoes membrane trafficking, combine with FM4-64 staining to track endocytic pathways.

  • Cell cycle dynamics: To assess localization changes during cell cycle, combine with Sad1-mRFP (spindle pole body marker) or Rlc1-GFP (contractile ring) as reference points for cell cycle stages, particularly important given S. pombe's well-characterized cell cycle .

How can I determine if SPCC569.06 undergoes post-translational modifications?

To characterize post-translational modifications (PTMs) of SPCC569.06:

  • Glycosylation analysis: Given S. pombe's protein glycosylation pathways, analyze N-linked and O-linked glycosylation using:

    • Endoglycosidase H treatment to remove N-linked glycans

    • PNGase F resistance to detect O-mannosylation

    • Migration shifts on SDS-PAGE before and after glycosidase treatments

  • Phosphorylation detection:

    • Immunoprecipitate tagged SPCC569.06 and analyze by mass spectrometry

    • Use Phos-tag SDS-PAGE to visualize phosphorylated protein variants

    • Apply λ-phosphatase treatment to confirm phosphorylation

  • Ubiquitination and SUMOylation:

    • Co-immunoprecipitation with ubiquitin or SUMO antibodies

    • Use denaturing conditions to preserve these modifications during isolation

  • GPI anchor determination:

    • PI-PLC treatment to release GPI-anchored proteins

    • Phase separation using Triton X-114 to assess membrane association

S. pombe shares many features with humans in protein modification pathways, including similar glycosylation mechanisms, making it an excellent model for studying membrane protein PTMs .

What approaches can identify potential interacting partners of SPCC569.06?

To identify SPCC569.06 interaction partners, employ these complementary techniques:

  • Affinity purification-mass spectrometry (AP-MS):

    • Tag SPCC569.06 with tandem affinity purification (TAP) tag

    • Use mild detergents (0.5-1% digitonin or 0.5% CHAPS) for membrane protein extraction

    • Cross-linking with formaldehyde (0.1-0.5%) can stabilize transient interactions

    • Analyze co-purified proteins by LC-MS/MS

  • Proximity-dependent biotin identification (BioID):

    • Fuse SPCC569.06 with a promiscuous biotin ligase (BirA*)

    • After biotin addition, purify biotinylated proteins using streptavidin

    • This method captures even transient or weak interactions

  • Genetic interaction mapping:

    • Synthetic genetic array (SGA) analysis crossing SPCC569.06Δ with S. pombe deletion library

    • Synthetic growth defects suggest functional relationships

  • Split-ubiquitin yeast two-hybrid system:

    • Specifically designed for membrane proteins

    • Allows screening potential interactions in the membrane environment

  • Co-immunoprecipitation validation:

    • Verify key interactions with reciprocal co-IP experiments

    • Use appropriate controls (non-specific IgG, unrelated membrane proteins)

How can I assess the role of SPCC569.06 in heterochromatin formation?

Given the genomic location of SPCC569.06 near regions involved in heterochromatin formation , these methods can assess its potential role in this process:

  • Chromatin immunoprecipitation sequencing (ChIP-seq):

    • Perform ChIP-seq for heterochromatin marks (H3K9me, Swi6) in wildtype vs. SPCC569.06Δ

    • Focus analysis on subtelomeric regions where ectopic heterochromatin is known to form

    • Compare with datasets from established heterochromatin regulators like epe1Δ

  • RNA-seq analysis:

    • Analyze transcriptome changes in SPCC569.06Δ strains

    • Look specifically for de-repression of genes normally silenced by heterochromatin

    • Perform differential expression analysis using DESeq2 or similar tools

  • Genetic interaction testing:

    • Create double mutants with known heterochromatin factors (clr4Δ, swi6Δ, epe1Δ)

    • Test for epistatic relationships through phenotypic analysis

    • Determine if SPCC569.06Δ affects variegation phenotypes in reporter strains

  • Imaging-based assays:

    • Use fluorescence microscopy to track heterochromatin clustering in SPCC569.06Δ

    • Examine co-localization with Swi6-GFP or other heterochromatin markers

How do I establish a protocol for purifying recombinant SPCC569.06 while maintaining native conformation?

Purifying membrane proteins like SPCC569.06 while preserving native conformation requires specialized approaches:

  • Expression optimization:

    • Compare homologous (S. pombe) vs. heterologous (E. coli, insect cells) expression

    • Test different fusion tags: His6, MBP, SUMO (enhances solubility)

    • Optimize induction conditions (temperature, inducer concentration, time)

  • Membrane extraction:

    • Screen detergents systematically: start with mild detergents (DDM, LMNG, GDN)

    • Determine critical micelle concentration (CMC) for each detergent

    • Use detergent:protein ratio optimization grids (typically 1:1 to 10:1)

  • Purification strategy:

    • Tandem purification combining affinity chromatography and size exclusion

    • Add cholesterol hemisuccinate (CHS) to stabilize membrane proteins

    • Include appropriate lipids (POPE, POPG) during purification

  • Conformation assessment:

    • Circular dichroism to verify secondary structure

    • Fluorescence size exclusion chromatography (FSEC) for homogeneity

    • Negative-stain electron microscopy for initial structural evaluation

  • Reconstitution options:

    • Nanodiscs with MSP1D1 scaffold protein

    • Reconstitution into liposomes with S. pombe lipid composition

    • Amphipol (A8-35) exchange for enhanced stability

What genetic screening approaches can uncover the function of SPCC569.06?

For comprehensive genetic screening to elucidate SPCC569.06 function:

  • Synthetic genetic interaction mapping:

    • Cross SPCC569.06Δ with the S. pombe deletion library (~3,400 non-essential genes)

    • Identify synthetic lethal/sick interactions through colony size measurement

    • Use the S. pombe genetic interaction map to contextualize results

  • Chemical-genetic profiling:

    • Expose SPCC569.06Δ and wildtype strains to diverse compounds

    • Measure growth differences to identify compound sensitivities

    • Connect sensitivities to specific cellular pathways

  • Multicopy suppressor screening:

    • Transform SPCC569.06Δ (if viable) or conditional mutant with S. pombe genomic library

    • Select for clones that rescue mutant phenotypes

    • This approach has successfully identified functional relationships in S. pombe

  • Transcriptome analysis:

    • Perform RNA-seq on SPCC569.06Δ vs. wildtype under various conditions

    • Use clustering analysis to identify co-regulated genes

    • Compare with existing datasets for mechanistic insights

  • CRISPR-based screens:

    • Implement CRISPRi for genome-wide knockdown in SPCC569.06Δ background

    • Use growth phenotypes or reporter systems to identify genetic interactions

How should I analyze transcriptomic data to identify pathways affected by SPCC569.06 deletion?

For robust transcriptomic analysis of SPCC569.06Δ effects:

  • Experimental design:

    • Include at least 3-4 biological replicates per condition

    • Consider multiple timepoints if studying inducible systems

    • Include positive controls (deletion of characterized genes in related pathways)

  • Bioinformatic analysis pipeline:

    • Quality control: FastQC, adapter trimming with Trimmomatic

    • Alignment: HISAT2 or STAR against the S. pombe genome

    • Quantification: featureCounts or HTSeq for gene-level counts

    • Differential expression: DESeq2 or edgeR with FDR ≤ 0.05 and |log2FC| ≥ 1

  • Pathway analysis:

    • Gene Ontology enrichment using PomBase GOSlim

    • KEGG pathway mapping specific to S. pombe

    • Gene Set Enrichment Analysis with rank-based statistics

  • Integration with existing datasets:

    • Compare with transcriptome profiles of heterochromatin mutants (clr4Δ, swi6Δ, epe1Δ)

    • Analyze overlap with stress response genes and cell cycle regulators

    • Cross-reference with protein interaction networks

  • Validation experiments:

    • RT-qPCR for key differentially expressed genes

    • Reporter assays for significantly affected promoters

    • Phenotypic analysis of mutants in identified pathways

What statistical approaches are appropriate for analyzing phenotypic data in SPCC569.06 studies?

For rigorous statistical analysis of phenotypic data:

  • Growth rate analysis:

    • Use area under the curve (AUC) from growth curves rather than endpoint measurements

    • Apply mixed-effects models to account for plate position effects

    • Compare multiple growth parameters: lag phase, maximum growth rate, carrying capacity

  • Morphological phenotypes:

    • Quantify cell length, width, and septation index from at least 100 cells per condition

    • Apply non-parametric tests (Mann-Whitney U) for non-normally distributed measurements

    • Use multiple comparison correction (Bonferroni or FDR) when testing various conditions

  • Fluorescence quantification:

    • Analyze at least 50-100 cells per experiment

    • Report both mean/median intensity and variation (coefficient of variation)

    • Use ANOVA with post-hoc tests for multiple condition comparisons

  • Survival assays:

    • Apply Kaplan-Meier analysis for time-to-event data

    • Use Cox proportional hazards models for covariate analysis

    • Report hazard ratios with confidence intervals

  • Experimental design considerations:

    • Power analysis to determine sample size (typically aiming for 80% power)

    • Blinded analysis to prevent experimenter bias

    • Include appropriate controls in every experiment (positive, negative, and procedural)

What are the most common technical challenges when working with SPCC569.06 and how can they be overcome?

Common challenges when studying membrane proteins like SPCC569.06 include:

  • Low expression levels:

    • Optimize codon usage for expression host

    • Use stronger promoters (full-strength nmt1) for initial detection

    • Try N-terminal fusion tags that enhance expression (MBP, SUMO)

    • Reduce growth temperature to 25°C during expression

  • Protein aggregation:

    • Test multiple detergents systematically (DDM, LMNG, GDN, CHAPS)

    • Add stabilizing agents: glycerol (10%), specific lipids, cholesterol

    • Optimize buffer conditions (pH, salt concentration, reducing agents)

    • Consider fusion partners known to enhance solubility

  • Non-specific antibody binding:

    • Generate peptide-specific antibodies against unique regions of SPCC569.06

    • Validate antibody specificity using SPCC569.06Δ as negative control

    • Pre-clear lysates with protein A/G beads before immunoprecipitation

    • Use tandem affinity purification to reduce background

  • Inconsistent phenotypes:

    • Control for cell density effects by standardizing inoculation OD600

    • Monitor strain background using diagnostic PCR to prevent contamination

    • Test phenotypes across multiple growth phases and media conditions

    • Quantify phenotype penetrance across population using single-cell analysis

  • Genetic manipulation difficulties:

    • Use long flanking homology (500-1000 bp) for gene targeting

    • Include rescue constructs if SPCC569.06 is essential

    • Consider conditional systems (tetracycline-regulatable or auxin-inducible)

    • Validate genomic modifications by both PCR and sequencing

How can I distinguish between specific phenotypes and artifacts when characterizing SPCC569.06?

To differentiate genuine phenotypes from experimental artifacts:

  • Comprehensive controls:

    • Use multiple independent deletion/mutant strains

    • Include reintegration of wildtype SPCC569.06 as complementation control

    • Compare with phenotypes of unrelated membrane protein deletions

  • Dose-dependent verification:

    • Test graded expression levels using thiamine-repressible promoters

    • Establish phenotype correlation with protein abundance

    • Perform titration experiments with conditional alleles

  • Environmental sensitivity assessment:

    • Test phenotype stability across various growth conditions

    • Control for media batch effects by preparing large standardized stocks

    • Evaluate phenotype persistence after multiple passages

  • Cross-validation with orthogonal methods:

    • Combine genetic, biochemical, and imaging approaches

    • Verify key findings using multiple methodological approaches

    • Use external datasets to contextualize observed phenotypes

  • Quantitative analysis:

    • Implement automated, high-throughput phenotyping where possible

    • Apply statistical tests appropriate for data distribution

    • Report effect sizes in addition to p-values for better interpretation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.