Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C61.05 (SPCC61.05)

Shipped with Ice Packs
In Stock

Description

Research Context and Functional Insights

While SPCC61.05 remains functionally uncharacterized, its study aligns with broader research on membrane protein biogenesis in S. pombe.

Relevant Biological Pathways

  • Membrane Protein Integration: Studies in S. pombe and other models highlight the role of the Sec61 translocon and ER Membrane Complex (EMC) in inserting transmembrane domains into the ER membrane . For example, the EMC facilitates the integration of type III transmembrane proteins (TMPs) through a Sec61-dependent mechanism .

  • Signal Peptidase Regulation: Proteins like Spc1 modulate signal peptidase (SPase) activity, protecting transmembrane segments from cleavage . Such regulatory mechanisms may influence the biogenesis of uncharacterized membrane proteins like SPCC61.05.

Current Research Gaps

  • Functional Annotation: No direct evidence links SPCC61.05 to specific cellular processes (e.g., transport, signaling).

  • Interaction Partners: No reported studies on its binding partners or subcellular localization.

Applications in Research

SPCC61.05 serves as a tool for studying:

  1. Membrane Protein Biogenesis: Used to probe general pathways of membrane protein folding and integration .

  2. Antibody Development: ELISA kits incorporating this protein enable detection of specific antibodies or interactions .

  3. Structural Studies: The recombinant form facilitates in vitro analyses of membrane protein topology and stability .

Comparative Analysis of Recombinant Preparations

Multiple vendors offer SPCC61.05 with similar specifications:

VendorProduct CodeHost SystemPurityPrice (USD)
CSBCSB-CF529656SXVS. pombe (cell-free)>85% (SDS-PAGE)$1,810.00
MyBioSourceMBS7040165S. pombe (cell-free)>85% (SDS-PAGE)Not listed
AfigenCSB-CF529656SXVS. pombe (cell-free)>85% (SDS-PAGE)$1,810.00

Future Directions

  1. Functional Characterization: CRISPR-based knockout studies in S. pombe to identify phenotypic effects.

  2. Structural Elucidation: Cryo-EM or NMR studies to resolve its 3D structure and membrane topology.

  3. Interaction Mapping: Co-IP or proximity-dependent biotinylation (BioID) to identify binding partners.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize its development.
Synonyms
SPCC61.05; Uncharacterized membrane protein C61.05
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-469
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC61.05
Target Protein Sequence
DSSEEAVDAPLDVKDDTGNKDYYKDSTGAYHFDKLIVTPLEYRDGESWKQSVIYCDLIFA KENKEEKGSFVKAQLKEDAEHPFIYRLLKLQTPLETYRGFIDGKNTEILDEIKSINLFED FLSESLVPEISPSVNIPIDETALYCFIGIQETEPIRIPWPVLTVEFYGDAPPPESYFRTI KSTLLAISMFLGFITLTWLLRCIKSQSGVQPAQISLAFWVFIFVFTHSYQVYSMVAIGRG SFSTWYVVSFLFSLVFEEGLEQSAYTSFLLVLCFGLGITKPALVKYYVYLAFVAFVQGLF VTFAPLSYPVMSFYGVRGILLKLIWNIYTFVYYGLPFFAVYRLYKQAGESRKLGFEAKYS LLRTCYIALAAVTVSNCLFLGVVRPLLGSQLSLGFQLITSCITFVDFLVFAFLFDCSKFV FLKYQPIPFEWYALESMESLNLEPAPDRKV
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the structural features of the SPCC61.05 membrane protein?

SPCC61.05 is an uncharacterized membrane protein in Schizosaccharomyces pombe with UniProt accession number O94349. The protein consists of 469 amino acids with the expression region spanning residues 20-469. The amino acid sequence contains multiple hydrophobic regions consistent with transmembrane domains, suggesting its localization within cellular membranes . Current structural data is limited, but sequence analysis indicates potential transmembrane helices that would anchor the protein within the lipid bilayer. No crystal or cryo-EM structure has been resolved to date, making computational prediction methods valuable for initial characterization studies.

How does SPCC61.05 compare to other membrane proteins in S. pombe?

Unlike well-characterized S. pombe membrane proteins such as the components of (1,3)beta-D-glucan synthase that interact with protein kinase C homologues (pck1p and pck2p), SPCC61.05 remains largely uncharacterized . Comparative sequence analysis shows limited homology with other fission yeast membrane proteins. Unlike pck1p and pck2p, which have established roles in cell wall integrity and interact with rho GTPases, SPCC61.05's interacting partners and regulatory mechanisms remain to be elucidated. Researchers should consider studying its evolutionary conservation across Schizosaccharomyces species to gain insights into functional significance.

What expression patterns does SPCC61.05 exhibit during different growth phases?

Current research has not fully characterized the expression patterns of SPCC61.05 across growth phases. To determine this, researchers should implement time-course studies using quantitative PCR or RNA-seq approaches through the lag, exponential, and stationary phases of S. pombe growth. Additionally, examining expression under different stress conditions (nutrient limitation, oxidative stress, temperature shifts) would provide valuable information about potential regulatory mechanisms. Correlation with cell cycle progression markers would further elucidate whether expression is constitutive or cell cycle-dependent.

What are the optimal conditions for expressing recombinant SPCC61.05 for functional studies?

For recombinant expression of SPCC61.05, researchers should consider using either the native S. pombe system or heterologous expression systems optimized for membrane proteins. When using the native system, the nmt1 promoter series (with thiamine-repressible expression) allows for controlled induction levels. For heterologous expression, specialized Pichia pastoris or E. coli strains designed for membrane protein expression (such as C41/C43 or Lemo21) often yield better results.

The recommended expression protocol includes:

  • Cloning the coding sequence (residues 20-469) into appropriate expression vectors

  • Including purification tags that minimally interfere with protein folding (C-terminal His6 or Strep-tag II)

  • Optimizing induction conditions (temperature: 16-18°C for heterologous systems; 25-30°C for S. pombe)

  • Extraction using mild detergents (DDM, LMNG) to maintain native conformation

For storage, the protein should be maintained in Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for extended storage .

What techniques are most effective for studying SPCC61.05 localization and trafficking in S. pombe cells?

To study the localization and trafficking of SPCC61.05, researchers should implement a multi-faceted approach:

  • Fluorescent protein tagging: Create C-terminal GFP or mCherry fusion constructs under native promoter control to visualize localization in living cells

  • Immunofluorescence microscopy: Develop specific antibodies against SPCC61.05 for fixed-cell imaging

  • Subcellular fractionation: Separate cellular components and detect protein presence by Western blotting

  • Co-localization studies: Use known organelle markers to determine specific membrane localization

For trafficking studies, photoactivatable fluorescent proteins or SNAP-tag pulse-chase methodologies can track protein movement over time. When designing these experiments, researchers must account for the potential impact of phosphorylation on protein localization, as observed with other S. pombe proteins like Rad60, which shows altered localization following Cds1Chk2-dependent phosphorylation .

How can researchers effectively generate and validate SPCC61.05 knockout or mutant strains?

For generating SPCC61.05 knockout or mutant strains, researchers should consider:

Knockout generation:

  • CRISPR-Cas9 system adapted for S. pombe

  • Homologous recombination with kanMX6 or other selection cassettes

  • Conditional knockouts if complete deletion proves lethal

Site-directed mutagenesis approach:

  • Identify conserved domains or predicted functional residues

  • Create point mutations in these regions

  • Replace native gene with mutant versions via homologous recombination

Validation methods:

  • PCR verification of genomic integration

  • RT-qPCR to confirm transcript absence/modification

  • Western blotting to verify protein absence/modification

  • Phenotypic analysis compared to wild-type strains

Researchers should examine effects on growth rate, cell morphology, membrane integrity, and response to various stressors (osmotic, temperature, cell wall-disrupting agents). Drawing from methodologies used to study other S. pombe membrane proteins like those involved in cell wall biosynthesis would be valuable for phenotypic assessment .

How might SPCC61.05 integrate with known S. pombe signaling pathways?

Based on research with other S. pombe membrane proteins, SPCC61.05 could potentially interact with several established signaling networks:

Signaling PathwayPotential SPCC61.05 InvolvementExperimental Approach
Cell wall integritySensor or effector in Rho1/Rho2-PCK pathwayCo-immunoprecipitation with Rho GTPases and PCK proteins
Stress-activated MAPKResponse to membrane or cell wall stressPhosphoproteomics under stress conditions
Mating/pheromone responseMembrane reorganization during conjugationAnalysis in mating-type switching mutants
Cell cycle regulationMembrane remodeling during divisionSynchronization and time-course expression

To investigate these possibilities, researchers should conduct interactome studies using BioID or proximity labeling techniques specifically adapted for membrane proteins. Additionally, phosphoproteomic analysis under various conditions would reveal whether SPCC61.05 is regulated by kinases such as Pck1/Pck2, which are known to regulate other membrane-associated processes . Epistasis analysis with components of these pathways would further clarify functional relationships.

What approaches can resolve contradictory findings about SPCC61.05 function?

When encountering contradictory findings regarding SPCC61.05 function, researchers should implement a systematic approach:

  • Strain background reconciliation: Ensure all experiments use identical or well-documented S. pombe strains, as genetic background can significantly influence membrane protein function

  • Tagging strategy comparison: Test whether protein tags in different positions (N-terminal, C-terminal, internal) differentially affect function

  • Growth condition standardization: Establish precise growth parameters (media composition, temperature, growth phase) for reproducibility

  • Multi-method validation: Confirm findings using complementary techniques:

    • Genetic approaches (deletion, point mutation)

    • Biochemical assays (in vitro reconstitution)

    • Cell biological observations (localization, trafficking)

    • Omics approaches (interactome, transcriptome upon deletion)

  • Functional redundancy exploration: Identify potential redundant proteins that might mask phenotypes in single mutants

This integrated approach mirrors successful resolution of contradictory findings in other S. pombe systems, such as those involving the role of chromatin modifiers in donor selection during mating-type switching .

How can researchers distinguish between direct and indirect effects when studying SPCC61.05 deletion phenotypes?

Distinguishing direct from indirect effects requires rigorous experimental design:

  • Acute versus chronic depletion comparison:

    • Create an auxin-inducible degron (AID) system for rapid SPCC61.05 depletion

    • Compare immediate effects (likely direct) with long-term adaptation (potentially indirect)

  • Structure-function analysis:

    • Generate a series of point mutations in different domains

    • Correlate specific mutations with discrete phenotypic effects

  • Suppressor screening:

    • Identify mutations that suppress SPCC61.05 deletion phenotypes

    • Map these to specific pathways to understand compensatory mechanisms

  • Temporal analysis of molecular events:

    • Establish the sequence of cellular changes following protein depletion

    • Early events are more likely to represent direct consequences

This approach is analogous to strategies used to decipher the role of Set1C components in mating-type switching, where mutant defects were investigated in strains with reversed donor loci or when recombination enhancers were deleted or transposed .

What bioinformatic tools are most appropriate for predicting SPCC61.05 function based on sequence data?

For predicting SPCC61.05 function from sequence data, researchers should employ a comprehensive bioinformatic workflow:

Analysis TypeRecommended ToolsOutput Interpretation
Transmembrane topologyTMHMM, Phobius, TOPCONSConsensus prediction of membrane-spanning regions
Domain predictionInterProScan, SMART, PfamIdentification of conserved functional domains
Structural modelingAlphaFold2, SWISS-MODEL3D structure predictions with confidence scores
Sequence conservationConSurf, Rate4SiteEvolutionary conservation mapping to identify functional hotspots
Post-translational modificationsNetPhos, UbPred, GPSPrediction of regulatory modification sites
Protein-protein interactionsSTRING, PrePPIPotential interaction partners based on co-evolution

Researchers should integrate these predictions and generate testable hypotheses about protein function. For example, highly conserved residues located in predicted functional domains should be prioritized for site-directed mutagenesis. Additionally, comparison with the limited functional data available for other uncharacterized membrane proteins in S. pombe would provide contextual information for interpretation.

How should researchers design experiments to determine if SPCC61.05 interacts with known membrane protein complexes in S. pombe?

To investigate potential interactions between SPCC61.05 and known membrane protein complexes:

  • Co-immunoprecipitation studies:

    • Tag SPCC61.05 with epitope tags (HA, Myc, FLAG)

    • Use mild detergents (digitonin, CHAPS) to preserve membrane protein complexes

    • Analyze precipitates by mass spectrometry to identify interacting partners

  • Proximity labeling in living cells:

    • Fuse SPCC61.05 with BioID2 or TurboID enzyme

    • Allow biotinylation of proximal proteins in vivo

    • Identify biotinylated proteins by streptavidin pulldown and mass spectrometry

  • Split-reporter assays:

    • Create fusions with split GFP or split luciferase

    • Test against components of known complexes (e.g., glucan synthase components)

    • Visualize interactions in living cells

  • Genetic interaction mapping:

    • Create double mutants with components of known complexes

    • Analyze synthetic lethality or suppression phenotypes

    • Generate comprehensive genetic interaction profiles

When designing these experiments, researchers should consider the approach used to study interactions between S. pombe protein kinase C homologues (pck1p and pck2p) and their GTPase partners, which successfully mapped interaction domains and functional consequences of binding .

What controls and validations are essential when developing antibodies against SPCC61.05 for immunological studies?

When developing antibodies against SPCC61.05, researchers must implement rigorous controls:

  • Epitope selection strategy:

    • Choose multiple epitopes from predicted extramembrane regions

    • Verify epitope uniqueness within the S. pombe proteome

    • Consider both peptide antibodies and those raised against recombinant protein fragments

  • Validation in knockout/knockdown strains:

    • Demonstrate signal absence in SPCC61.05 deletion strains

    • Show signal reduction in conditional knockdown strains

    • Document antibody specificity across different extraction conditions

  • Cross-reactivity assessment:

    • Test against whole cell lysates from wild-type and knockout strains

    • Perform pre-absorption controls with immunizing antigen

    • Evaluate specificity in different subcellular fractions

  • Application-specific validation:

    • For Western blotting: Demonstrate single band of expected molecular weight

    • For immunofluorescence: Show expected subcellular pattern that disappears in knockouts

    • For immunoprecipitation: Confirm pull-down of known interacting proteins

These validation steps ensure that subsequent experimental results using these antibodies can be interpreted with confidence. Researchers should also consider developing monoclonal antibodies for long-term reproducibility in addition to polyclonal antibodies that might offer higher sensitivity.

How can multi-omics approaches be combined to comprehensively characterize SPCC61.05 function?

An integrative multi-omics strategy provides the most comprehensive approach to characterizing SPCC61.05:

Omics ApproachSpecific ApplicationExpected Insight
TranscriptomicsRNA-seq of knockout vs. wild-typeGenes affected by SPCC61.05 deletion
ProteomicsTMT-based quantitative proteomicsProtein level changes in response to deletion
PhosphoproteomicsTiO2 enrichment followed by MSAltered signaling pathways
MetabolomicsLC-MS/MS of cellular metabolitesMetabolic consequences of deletion
LipidomicsTargeted membrane lipid analysisEffects on membrane composition
InteractomicsBioID coupled with quantitative MSProtein interaction network

Integration of these datasets requires sophisticated bioinformatic approaches including:

  • Pathway enrichment analysis

  • Network reconstruction

  • Causal reasoning algorithms

  • Multi-omics data visualization tools

This integrated approach would mirror the comprehensive strategies used to study other S. pombe regulatory systems, such as those employed to understand mating-type switching mechanisms , but with specific adaptations for membrane protein biology.

What experimental designs can determine if SPCC61.05 functions differently during various cell cycle stages?

To investigate cell cycle-dependent functions of SPCC61.05:

  • Synchronization approaches:

    • Nitrogen starvation and release

    • Hydroxyurea block and release

    • cdc25-22 temperature-sensitive mutant synchronization

    • Lactose gradient centrifugation for size-based separation

  • Time-course analyses:

    • Quantitative measurements of SPCC61.05 abundance

    • Phosphorylation state analysis at different cell cycle stages

    • Localization studies throughout the cell cycle

    • Protein-protein interaction dynamics

  • Cell cycle-specific perturbation:

    • Inducible degron system activated at specific cell cycle points

    • Cell cycle-specific promoter driving dominant-negative variants

    • Rapid inhibition using small-molecule approaches if binding sites are identified

  • Correlation with known cell cycle factors:

    • Co-immunoprecipitation with cell cycle regulators

    • Genetic interactions with cell cycle mutants

    • Phenotypic analysis of deletion strains at different cell cycle arrests

This experimental design should consider the approach used to study the cell cycle-dependent phosphorylation of Rad60, which becomes phosphorylated in response to hydroxyurea-induced DNA replication arrest in a Cds1Chk2-dependent manner .

How should researchers approach studying potential post-translational modifications of SPCC61.05?

A comprehensive investigation of SPCC61.05 post-translational modifications requires:

  • In silico prediction:

    • Phosphorylation site prediction (NetPhos, GPS)

    • Ubiquitination site prediction (UbPred)

    • Glycosylation site prediction (NetNGlyc, NetOGlyc)

    • Other PTM site predictions (SUMOylation, acetylation)

  • Mass spectrometry approaches:

    • Enrichment strategies for specific modifications

    • Multiple protease digestion to maximize sequence coverage

    • Targeted MS/MS for predicted modification sites

    • Quantitative analysis across different conditions

  • Functional validation:

    • Site-directed mutagenesis of predicted modification sites

    • Phospho-mimetic and phospho-null mutations

    • Assessment of functional consequences in vivo

    • In vitro enzymatic assays to confirm modification

  • Regulatory enzyme identification:

    • Candidate approach testing known kinases/phosphatases

    • Kinase inhibitor screening

    • Co-immunoprecipitation with regulatory enzymes

    • Genetic screening for modifiers of SPCC61.05 phenotypes

This approach should consider findings from studies of other S. pombe proteins, such as Rad60, which undergoes Cds1Chk2-dependent phosphorylation with functional consequences for protein localization and activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.