Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C622.01c (SPCC622.01c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPCC622.01c; Uncharacterized membrane protein C622.01c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC622.01c
Target Protein Sequence
MTVDNVFIHAVPREQIRRRYSYFEAFEKNCHIQGILSKRALYMLIPCFMEFAVGSIVYSF GVPGWVLGMNTVLAAGFLVMFLFLVWPCFQLVDERQIEEPGEDEMALNAGGYYPYAEEVP PPSYPSLEEENEGNEEIEESEEMNTLLSK
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for studying SPCC622.01c?

For recombinant expression of S. pombe membrane proteins like SPCC622.01c, several systems can be employed:

The optimal choice depends on your research goals. For structural studies requiring large quantities, yeast or insect cell systems are preferable. For preliminary functional screening, bacterial systems might be sufficient .

How can I verify the subcellular localization of SPCC622.01c?

To determine the subcellular localization of SPCC622.01c, multiple complementary approaches should be implemented:

  • GFP fusion protein analysis: Create C- or N-terminal GFP fusions of SPCC622.01c and observe localization via fluorescence microscopy. This approach has been successful for genome-wide protein localization studies in S. pombe, where approximately 70% of proteins have been localized using GFP tags .

  • Immunofluorescence: Use antibodies against the recombinant protein or epitope tags if fusion proteins are employed.

  • Subcellular fractionation: Isolate different cellular compartments (plasma membrane, ER, Golgi, etc.) and detect the protein using western blotting.

  • Proteomic analysis of isolated organelles: Use mass spectrometry to identify proteins in purified membrane fractions.

For optimal results, combine these methods to cross-validate localization findings .

What alternative splicing patterns have been observed for SPCC622.01c and how might they affect protein function?

Based on transcriptomic studies of S. pombe, alternative splicing occurs in numerous genes including membrane proteins. For SPCC622.01c:

  • Observed patterns: While specific splicing events for SPCC622.01c aren't explicitly documented in the provided materials, research on fission yeast meiosis has revealed that many uncharacterized membrane proteins undergo alternative splicing. The dominant type of alternative splicing event in S. pombe is intron retention, followed by "intron in exon" patterns .

  • Potential functional implications: Alternative splicing could lead to:

    • Altered transmembrane domains affecting membrane insertion

    • Modified cytoplasmic domains altering signaling capabilities

    • Production of truncated proteins with dominant-negative effects

  • Temporal regulation: Some novel isoforms of S. pombe proteins exhibit distinct temporal patterns compared to annotated isoforms, suggesting differential regulation during cellular processes like meiosis .

To investigate alternative splicing in SPCC622.01c specifically, deep sequencing using PacBio or similar long-read technologies is recommended to identify full-length transcripts across different physiological conditions .

How can I design a comprehensive experimental approach to characterize the function of SPCC622.01c?

A systematic approach to characterizing SPCC622.01c should include:

  • Gene deletion and phenotypic analysis:

    • Create a SPCC622.01c deletion strain

    • Analyze growth under various conditions (different temperatures, carbon sources, stress inducers)

    • Screen for sensitivity to drugs targeting membrane functions

    • Examine cellular morphology and division patterns

  • Protein interaction studies:

    • Perform co-immunoprecipitation with tagged SPCC622.01c

    • Use proximity labeling methods (BioID or APEX) to identify nearby proteins

    • Employ yeast two-hybrid or split-ubiquitin systems for membrane protein interactions

  • Functional assays based on localization:

    • If localized to plasma membrane: measure transport of various substrates

    • If in secretory pathway: analyze protein trafficking

    • If mitochondrial: examine respiratory functions

  • Structure-function analysis:

    • Perform site-directed mutagenesis of conserved residues

    • Create truncation variants to identify functional domains

    • Test chimeric proteins with related membrane proteins

  • Expression analysis:

    • Quantify expression changes under different conditions using RT-qPCR

    • Analyze correlation with functionally related genes

This multi-faceted approach maximizes the chances of finding functional clues for this uncharacterized protein .

What computational tools and databases are most useful for predicting the function of uncharacterized membrane proteins like SPCC622.01c?

For computational analysis of uncharacterized membrane proteins like SPCC622.01c, the following tools and databases are particularly valuable:

  • Structural prediction tools:

    • TMHMM/TOPCONS: For transmembrane domain prediction

    • AlphaFold/RoseTTAFold: For 3D structure prediction

    • SignalP: For signal peptide prediction

  • Functional analysis tools:

    • InterProScan: For domain and functional site identification

    • BLAST/HHpred: For detecting distant homologs

    • ConSurf: For evolutionary conservation analysis

    • ProClusEnsem: Specific for membrane protein type prediction using ensemble distance metrics

  • S. pombe-specific resources:

    • PomBase: Comprehensive database for S. pombe genes, contains functional annotations and genetic interaction data

    • Ortholog databases: Identification of orthologs in other organisms with known functions

  • Experimental data integration:

    • STRING: For protein-protein interaction network analysis

    • Expression correlation databases: To identify co-expressed genes

  • Specialized membrane protein databases:

    • TransportDB: For transport protein annotation

    • TCDB: Transport protein classification

Combining predictions from multiple tools increases confidence in functional hypotheses, which should then be experimentally validated .

How can I establish a structure-function relationship for SPCC622.01c using contemporary structural biology techniques?

Determining structure-function relationships for SPCC622.01c requires integrating multiple structural biology approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Express and purify SPCC622.01c at high concentration (>1 mg/ml)

    • Solubilize using appropriate detergents (DDM, LMNG) or reconstitute in nanodiscs

    • Collect high-resolution data using direct electron detectors

    • Process using software packages like RELION or cryoSPARC

    • Advantages: Works well for membrane proteins; doesn't require crystallization

  • X-ray crystallography:

    • Screen multiple constructs with various truncations

    • Test different detergents and lipid cubic phase crystallization

    • Consider fusion proteins (T4 lysozyme, BRIL) to increase solubility

    • Advantages: Potentially higher resolution than Cryo-EM

  • NMR spectroscopy:

    • Express isotope-labeled protein (15N, 13C)

    • Particularly useful for flexible regions and dynamics studies

    • Consider solid-state NMR for intact membrane environment

  • Integrative approaches:

    • Combine low-resolution structural data with computational modeling

    • Use cross-linking mass spectrometry to validate structural models

    • Apply EPR spectroscopy to probe conformational changes

  • Structure-guided functional validation:

    • Design mutations based on structural insights

    • Create chimeras swapping domains with related proteins

    • Test protein dynamics using FRET sensors

The methodology should be adapted based on initial results and the specific structural features of SPCC622.01c .

What role might SPCC622.01c play in drug resistance or sensitivity, and how can this be systematically investigated?

To investigate potential roles of SPCC622.01c in drug resistance or sensitivity:

  • Genomic deletion screening:

    • Compare growth of SPCC622.01c deletion mutants versus wild-type strains in the presence of various antifungal compounds

    • Screen across multiple drug classes (azoles, polyenes, echinocandins)

    • Quantify growth inhibition using standardized methodologies

  • Overexpression studies:

    • Create strains overexpressing SPCC622.01c

    • Test for acquired resistance to specific compounds

    • Measure minimum inhibitory concentration (MIC) changes

  • Localization changes upon drug exposure:

    • Monitor GFP-tagged SPCC622.01c localization before and after drug treatment

    • Analyze potential recruitment to drug-affected cellular compartments

  • Transcriptional response analysis:

    • Measure expression changes of SPCC622.01c upon drug exposure

    • Compare with known drug response genes

    • Examine correlation with stress response pathways

  • Drug-protein interaction studies:

    • Test direct binding of compounds using techniques like surface plasmon resonance

    • Perform cellular thermal shift assays (CETSA) to detect drug-induced stabilization

  • Integration with existing datasets:

    • Compare results with genomewide screens of S. pombe deletion mutants for antifungal sensitivity

    • Look for patterns among membrane proteins showing similar phenotypes

This systematic approach can reveal whether SPCC622.01c contributes to inherent or acquired drug resistance mechanisms, potentially identifying new therapeutic targets .

How can quantitative proteomics be applied to understand the functional network of SPCC622.01c?

Quantitative proteomics offers powerful approaches to elucidate the functional context of SPCC622.01c:

  • Proximity-dependent labeling combined with quantitative MS:

    • Express SPCC622.01c fused to BioID or APEX2

    • Allow in vivo labeling of proximal proteins

    • Quantify enriched proteins using SILAC, TMT, or label-free quantification

    • Map the spatial interactome around SPCC622.01c

  • Comparative proteomics of deletion mutants:

    • Compare proteomes of Δspcc622.01c mutants with wild-type strains

    • Quantify protein abundance changes using isobaric labeling

    • Identify compensatory mechanisms and affected pathways

    • Focus on membrane protein fractions for targeted analysis

  • Chromatin-associated protein analysis:

    • If SPCC622.01c affects gene expression, analyze changes in chromatin-bound proteins

    • Use techniques developed for S. pombe chromatin proteomics

    • Quantify binding dynamics of transcription factors and chromatin remodelers

  • Protein post-translational modifications:

    • Map phosphorylation sites on SPCC622.01c

    • Identify conditions that trigger modification changes

    • Connect to signaling pathways through kinase/phosphatase networks

  • Time-resolved proteomics during cellular responses:

    • Monitor protein complex remodeling during stress responses

    • Quantify dynamic interactions during cell cycle progression

    • Correlate with phenotypic changes in deletion mutants

  • Data integration framework:

    Analysis TypeTechnologiesExpected OutputsIntegration Method
    InteractomeAP-MS, BioIDProtein interaction networkNetwork analysis
    Global proteomeSILAC, TMTDysregulated pathwaysPathway enrichment
    PTM analysisPhosphoproteomicsRegulatory sitesMotif analysis
    LocalizationMembrane fractionationCompartment assignmentSpatial mapping
    DynamicsPulse-SILACProtein turnover ratesKinetic modeling

This comprehensive proteomic strategy can reveal functional associations and regulatory mechanisms of SPCC622.01c, particularly important for uncharacterized membrane proteins where function is difficult to predict computationally .

What experimental design would best address potential contradictions in SPCC622.01c localization or function data?

When faced with contradictory data regarding SPCC622.01c localization or function, implement this systematic experimental design:

  • Standardized validation protocol:

    • Create a standardized checklist for experimental validation (following models like the Experimental Design Checklist C)

    • Include essential controls for each experiment type

    • Document all experimental conditions thoroughly

  • Multiple tagging strategies:

    • Generate N-terminal and C-terminal tagged versions

    • Use small epitope tags (HA, FLAG) alongside fluorescent proteins (GFP, mCherry)

    • Create internal tags at predicted loop regions

    • Validate each construct's functionality through complementation tests

  • Multi-condition analysis:

    • Examine protein localization and function across:

      • Different growth phases

      • Various stress conditions

      • Cell cycle stages

      • Nutritional states

    • Document condition-dependent changes systematically

  • Independent technique validation:

    TechniqueControl/ValidationExpected Outcome
    Fluorescence microscopyCo-localization with organelle markersConfirmation of subcellular compartment
    Fractionation + Western blotEnrichment in specific cellular fractionsBiochemical validation of localization
    Functional assaysRescue experiments with wildtype proteinVerification of functional readouts
    Proteomic analysisComparison with known organelle proteomesUnbiased assignment to cellular structures
  • Contradiction resolution framework:

    • Implement Solomon four-group experimental design to control for testing effects7

    • Use two-group pre/post test design for interventional studies

    • Employ statistical approaches to quantify confidence in contradictory results

    • Consider the possibility of dual localization or condition-dependent functions

  • Independent laboratory validation:

    • Establish collaboration for independent verification of key findings

    • Standardize protocols across laboratories

    • Conduct blind analysis of critical results

This rigorous approach helps resolve contradictions by systematically exploring all variables that might affect protein behavior, particularly important for membrane proteins that may show context-dependent localization or function 7.

What are the optimal conditions for expressing and purifying recombinant SPCC622.01c for structural and functional studies?

Optimizing expression and purification of SPCC622.01c requires careful consideration of multiple parameters:

  • Expression system selection:

    • Bacterial systems: Use C41(DE3) or C43(DE3) strains specifically developed for membrane proteins

    • Yeast systems: Consider Pichia pastoris for high-density cultures and native-like membrane environment

    • Insect cells: Sf9 or Hi5 cells can provide high yields with proper post-translational modifications

  • Expression optimization:

    • Temperature: Test reduced temperatures (16-20°C) to improve folding

    • Induction: Use lower inducer concentrations for slower expression

    • Media: Supplement with specific lipids if needed for proper folding

    • Fusion tags: Test MBP, SUMO, or Mistic fusions to enhance solubility

  • Solubilization screening:

    • Systematically test multiple detergents:

      Detergent ClassExamplesAdvantagesConsiderations
      MaltosideDDM, LMNGGentle, widely usedLarger micelles
      GlucosideOG, DMSmaller micellesCan be harsher
      Neopentyl glycolOGNG, DMNGSmaller micelles, stableNewer, less characterized
      ZwitterionicLDAO, FC-12Effective solubilizationCan be denaturing
    • Consider detergent mixtures for optimized extraction

  • Purification strategy:

    • Implement two-step minimum purification:

      1. Affinity chromatography (IMAC, anti-FLAG, etc.)

      2. Size exclusion chromatography to assess homogeneity

    • Consider GFP fusion for fluorescence-detection size-exclusion chromatography (FSEC)

    • Monitor protein stability through thermal shift assays

  • Alternative membrane mimetics:

    • Nanodiscs for a more native-like lipid environment

    • Amphipols for enhanced stability after detergent removal

    • SMALPs (styrene maleic acid lipid particles) for detergent-free extraction

  • Quality control assessments:

    • SEC-MALS to determine protein-detergent complex size

    • Negative-stain EM to verify homogeneity

    • Circular dichroism to confirm secondary structure

    • Functional assays to verify native-like behavior

This methodical approach maximizes the chances of obtaining properly folded, functional SPCC622.01c suitable for downstream structural and functional studies .

How can I design effective CRISPR-Cas9 strategies for generating SPCC622.01c mutants in S. pombe?

Designing effective CRISPR-Cas9 strategies for SPCC622.01c modification requires S. pombe-specific considerations:

  • S. pombe-optimized CRISPR systems:

    • Use plasmids with S. pombe-compatible promoters (e.g., rrk1, adh1)

    • Consider self-cleaving ribozymes for precise gRNA expression

    • Test both Cas9 and Cas12a (Cpf1) which may have different efficiency in S. pombe

  • Guide RNA design:

    • Select target sites using S. pombe-specific CRISPR design tools

    • Follow these guidelines for optimal efficiency:

      ParameterRecommendationRationale
      GC content40-60%Stability without excessive binding
      Self-complementarityAvoidPrevents secondary structure formation
      Poly-T sequencesAvoidPrevents premature transcription termination
      Target positionExon 1 if possibleEnsures early disruption of protein
      PAM sitesNGG for Cas9; TTTV for Cas12aRequired for nuclease function
    • Design 3-4 gRNAs per target to account for efficiency variations

  • Repair template design:

    • For point mutations:

      • Include 40-80 bp homology arms

      • Introduce silent mutations in the PAM or seed region to prevent re-cutting

    • For gene tagging:

      • Design in-frame fusions with flexible linkers (e.g., GGSGGS)

      • Include selectable markers with loxP sites for potential marker removal

  • Delivery methods:

    • Lithium acetate transformation for integrating plasmids

    • Consider ribonucleoprotein (RNP) delivery for transient expression

    • Use antibiotic or auxotrophic markers for selection

  • Screening strategies:

    • Colony PCR with primers flanking the modification site

    • Restriction enzyme digestion if the mutation creates/removes a site

    • Sanger sequencing for final confirmation

    • Phenotypic screening if applicable

  • Validation:

    • Sequencing of the entire targeted locus to check for unintended mutations

    • Western blotting to confirm protein expression changes

    • RT-qPCR to check transcript levels

    • Functional assays to verify the expected phenotype

This comprehensive approach addresses the specific challenges of CRISPR-Cas9 editing in S. pombe, which can have different efficiency compared to other model organisms .

What are the best approaches for studying protein-protein interactions involving SPCC622.01c, given the challenges of membrane protein analysis?

Studying protein-protein interactions (PPIs) involving membrane proteins like SPCC622.01c requires specialized approaches to overcome solubility and structural preservation challenges:

  • In vivo proximity-based methods:

    • BioID/TurboID: Fusion of biotin ligase to SPCC622.01c labels proximal proteins

      • Advantages: Works in native membrane environment; detects transient interactions

      • Implementation: Express SPCC622.01c-BioID fusion, add biotin, purify biotinylated proteins, identify by MS

    • APEX2 proximity labeling: Peroxidase-based labeling with shorter reaction time

      • Advantages: Minute-scale labeling; better temporal resolution

      • Implementation: Express SPCC622.01c-APEX2, add biotin-phenol, trigger with H₂O₂

  • Split-protein complementation assays:

    • Split-ubiquitin system: Specifically designed for membrane protein interactions

      • Advantages: Occurs at native membrane locations; low false positives for membrane proteins

      • Implementation: Fuse SPCC622.01c to C-terminal ubiquitin fragment (Cub) with transcription factor, test against N-terminal ubiquitin fragment (Nub) fusions

    • Bimolecular fluorescence complementation (BiFC): Visual detection of interactions

      • Advantages: Spatial information; works in intact cells

      • Implementation: Split fluorescent protein fragments fused to SPCC622.01c and potential partners

  • Crosslinking-based approaches:

    • In vivo chemical crosslinking: Preserves transient interactions

      • Advantages: Captures interactions in native environment

      • Implementation: Treat cells with membrane-permeable crosslinkers (DSP, DTBP), immunoprecipitate SPCC622.01c

    • Photo-crosslinking with unnatural amino acids: Site-specific interaction detection

      • Advantages: Precise interaction interface mapping

      • Implementation: Incorporate photo-reactive amino acids, activate with UV, identify crosslinked partners

  • Modified co-immunoprecipitation protocols:

    • Digitonin-based gentle solubilization: Preserves membrane protein complexes

      • Advantages: Maintains native interactions better than stronger detergents

      • Implementation: Optimize detergent concentration for maximum complex preservation

    • Covalent tag-based purification: For stable capture

      • Advantages: Stringent washes possible; reduced background

      • Implementation: HaloTag or SNAP-tag fusions with covalent capture

  • Quantitative interaction assessment:

    MethodQuantitative ParameterAdvantageLimitation
    FRETEnergy transfer efficiencyReal-time in vivo measurementRequires fluorescent tag functionality
    MSTThermophoretic mobilityLow sample consumptionRequires protein purification
    SPRBinding kinetics (kon/koff)Detailed binding parametersRequires protein purification
    ITCThermodynamic parametersComplete binding profileHigh protein amounts needed
  • Computational validation:

    • Use structural prediction to evaluate interaction feasibility

    • Apply coevolution analysis to predict interaction interfaces

    • Validate with integrative modeling approaches

This multi-faceted strategy accounts for the specific challenges of membrane protein interactions while providing complementary data types for confident interaction mapping .

How might transcriptomic and proteomic integration enhance our understanding of SPCC622.01c function in different physiological contexts?

Integrating transcriptomic and proteomic approaches can provide comprehensive insights into SPCC622.01c function:

  • Multi-omics experimental design:

    • Analyze matched samples across different conditions:

      • Normal growth vs. stress conditions

      • Different cell cycle stages

      • Nutrient limitation responses

      • Meiotic progression time points

    • Collect parallel samples for:

      • RNA-seq (transcriptome)

      • Ribosome profiling (translation)

      • Proteomics (protein abundance)

      • Phosphoproteomics (signaling)

  • Advanced transcriptome analysis for SPCC622.01c:

    • Long-read sequencing (PacBio, Nanopore) to identify alternative isoforms

    • Analysis of alternative splicing patterns across conditions

    • Measurement of transcript stability using pulse-chase approaches

    • RNA structure analysis to identify regulatory elements

  • Specialized proteomics for membrane proteins:

    • Targeted proteomics (PRM/MRM) to accurately quantify SPCC622.01c

    • PTM mapping to identify regulatory modifications

    • Spatial proteomics to confirm localization changes

    • Turnover analysis using metabolic labeling

  • Integrative data analysis framework:

    • Correlation analysis between transcript and protein levels

    • Network analysis to identify co-regulated genes/proteins

    • Temporal modeling of expression dynamics

    • Causality inference using perturbation data

  • Comparative analysis between wildtype and mutant strains:

    Data TypeAnalysis ApproachExpected Insights
    TranscriptomeDifferential expression analysisTranscriptional consequences of SPCC622.01c absence
    Alternative splicingIsoform quantificationSplicing regulation connections
    ProteomeProtein abundance changesPost-transcriptional effects
    PhosphoproteomePhosphorylation site changesSignaling pathway connections
    Protein-protein interactionsInteractome changesRemodeling of protein complexes
  • Integration with existing S. pombe datasets:

    • Comparison with meiotic gene expression patterns

    • Analysis in context of stress response networks

    • Correlation with cell cycle-regulated genes

This integrative approach can reveal:

  • Condition-specific functions of SPCC622.01c

  • Regulatory mechanisms controlling its expression

  • Downstream effects of SPCC622.01c activity

  • Potential participation in specific cellular pathways or processes

What emerging technologies might provide breakthrough insights into the function of uncharacterized membrane proteins like SPCC622.01c?

Several cutting-edge technologies hold promise for elucidating functions of uncharacterized membrane proteins like SPCC622.01c:

  • Advanced structural biology techniques:

    • Cryo-electron tomography (cryo-ET): Visualizing membrane proteins in their native cellular environment

    • Integrative structural biology: Combining cryo-EM, crosslinking-MS, and computational modeling

    • 4D structural biology: Time-resolved structural changes during protein activation

  • Single-cell and spatial technologies:

    • Single-cell proteomics: Detecting cell-to-cell variability in SPCC622.01c expression

    • Spatial transcriptomics/proteomics: Mapping subcellular localization with molecular context

    • Live-cell super-resolution microscopy: Tracking protein dynamics at nanometer resolution

  • Functional genomics innovations:

    • Perturb-seq: Combining CRISPR perturbations with single-cell RNA-seq

    • Base editing and prime editing: Precise genomic modifications without double-strand breaks

    • CRISPR activation/repression: Modulating SPCC622.01c expression without genetic modification

  • Protein engineering approaches:

    • Directed evolution in yeast: Selecting for variants with detectable functions

    • Synthetic protein scaffolds: Creating controllable membrane protein environments

    • Optogenetic tools: Light-controlled activation/inhibition of membrane protein function

  • Advanced computational methods:

    • AlphaFold-based interaction modeling: Predicting protein-protein interactions

    • Molecular dynamics simulations: Exploring conformational dynamics in membranes

    • Machine learning for functional prediction: Training on multi-omics datasets

  • Emerging technologies comparison:

    TechnologyApplication to SPCC622.01cPotential InsightsTechnical Challenges
    Microfluidic organoidsReconstitution of membrane functionTransport/signaling activitiesComplex setup, validation
    SMART-seq for membrane proteinsSingle-molecule analysis of traffickingDynamic localization patternsFluorophore accessibility
    Nanobody-based sensorsReal-time conformational changesActivation mechanismsNanobody development
    Deep mutational scanningComprehensive structure-function mapCritical functional residuesFunctional assay required
    In-cell NMRStructural dynamics in native environmentConformational landscapesSensitivity, assignment
  • Integration platforms:

    • Digital lab notebooks specifically designed for multi-omics integration

    • Machine learning platforms for uncharacterized protein function prediction

    • Collaborative research platforms for membrane protein characterization

These technologies, particularly when applied in combination, could overcome the traditional challenges in membrane protein analysis and provide unprecedented insights into SPCC622.01c function and regulation .

How might comparative analysis across different yeast species enhance our understanding of SPCC622.01c evolution and function?

Comparative analysis across fungal species can provide evolutionary context and functional insights for SPCC622.01c:

  • Phylogenetic profiling and evolutionary analysis:

    • Identify orthologs across diverse fungal species

    • Reconstruct evolutionary history using maximum likelihood methods

    • Calculate selection pressures (dN/dS ratios) to identify conserved functional regions

    • Map conservation onto predicted structural models

    • Compare with paralogs within S. pombe genome

  • Comparative genomics approaches:

    • Analyze synteny to understand genomic context conservation

    • Examine promoter regions for conserved regulatory elements

    • Identify co-evolved gene clusters suggesting functional relationships

    • Compare intron-exon structures across species

  • Cross-species functional complementation:

    • Express SPCC622.01c orthologs from different species in S. pombe deletion mutants

    • Test rescue of phenotypes to determine functional conservation

    • Create chimeric proteins with domains from different species to map functional regions

    • Perform heterologous expression in model systems like S. cerevisiae

  • Comparative expression analysis:

    • Compare expression patterns of orthologs across conditions in different species

    • Identify conserved regulation suggesting functional importance

    • Examine alternative splicing conservation across species

  • Comparative localization and interaction studies:

    • Compare subcellular localization patterns across species

    • Identify conserved protein-protein interactions

    • Map species-specific interactions suggesting specialized functions

  • Comparative data integration framework:

    Analysis TypeSpecies ComparisonExpected Insights
    Sequence conservationS. pombe, S. cerevisiae, C. albicansFunctionally important residues
    Structural predictionMultiple fungal orthologsConservation of structural features
    Expression correlationGene co-expression networksConserved functional modules
    Phenotypic profilesCross-species knockoutsFunctional conservation and divergence
    Interactome comparisonProtein interaction networksConserved complexes and pathways
  • Specialized evolutionary analyses:

    • Ancestral sequence reconstruction to infer evolutionary trajectory

    • Identification of lineage-specific adaptations

    • Analysis of horizontal gene transfer events if applicable

    • Examination of gene duplication and neofunctionalization events

This comparative approach can reveal:

  • Evolutionarily conserved functions representing core activities

  • Species-specific adaptations suggesting specialized roles

  • Functional constraints indicated by conserved sequence features

  • Potential functions based on characterized orthologs in other species

The evolutionary lens provides crucial context for understanding SPCC622.01c, particularly valuable for uncharacterized proteins where direct experimental evidence is limited .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.