Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C688.16 (SPAC688.16)

Shipped with Ice Packs
In Stock

Description

Protein Classification and Basic Properties

SPAC688.16 belongs to the broader category of uncharacterized membrane proteins in S. pombe. Membrane proteins in this organism are often polytopic, containing multiple transmembrane (TM) helices, and are involved in diverse cellular processes such as transport, signaling, and organelle function .

ParameterDetails
Gene IDSPAC688.16
Protein NameUncharacterized membrane protein C688.16
SpeciesSchizosaccharomyces pombe (Fission yeast)
Protein TypeIntegral membrane protein
Domain ArchitectureLikely polytopic, with TM helices (exact topology not experimentally determined)
Known InteractionsInteracts with ima1 (SPCC737.03c), an inner nuclear membrane protein

Notes:

  • Recombinant versions of SPAC688.16 have not been explicitly documented in commercial catalogs (e.g., Creative Biomart, MyBioSource), which primarily list related proteins like SPAC688.12c .

  • The protein’s subcellular localization and functional role remain unverified.

Functional Context and Genomic Insights

While SPAC688.16 lacks direct functional annotation, its association with ima1 (SPCC737.03c) suggests potential involvement in nuclear membrane dynamics. Ima1 is an integral inner nuclear membrane protein linked to chromatin organization and genome stability . Membrane proteins in S. pombe often participate in stress response pathways and cell cycle regulation, as seen with transcription factors like Atf1 and Pcr1 .

Key Observations:

  • Interaction Network: SPAC688.16 co-occurs in interaction datasets with proteins like SPAC750.07c and SPAC823.07, though functional relationships are uncharacterized .

  • Evolutionary Conservation: Homologs of SPAC688.16 may exist in other organisms, but sequence similarities are not well-documented.

Research Gaps and Future Directions

The lack of targeted studies on SPAC688.16 highlights critical gaps in understanding its role:

  1. Structural Characterization: TM helix topology and loop regions require experimental validation.

  2. Functional Assays: Knockout studies or fluorescent tagging could elucidate its subcellular localization (e.g., nuclear vs. plasma membrane).

  3. Post-Translational Modifications: Phosphorylation or ubiquitination patterns, common in membrane proteins , remain unexplored.

Experimental Recommendations:

  • Recombinant Protein Production: His-tagged or GFP-tagged constructs could facilitate biochemical studies, as demonstrated for similar proteins (e.g., P22H7.04) .

  • Proteomic Profiling: Co-immunoprecipitation (Co-IP) with ima1 or other interactors could map functional complexes .

Comparative Analysis of Related Proteins

For context, recombinant proteins like SPAC688.12c (Uncharacterized protein C688.12c) and P22H7.04 (His-tagged membrane protein) share structural features with SPAC688.16 but lack direct functional overlap .

ProteinSourceTagPurityKey Properties
SPAC688.16S. pombeN/AN/AUncharacterized membrane protein
SPAC688.12cRecombinantN/A≥85% (SDS-PAGE)Sequence orphan; partial domain structure
P22H7.04 (Pi027)E. coliHis-tagged>90% (SDS-PAGE)Full-length (1–255 aa); nuclear localization inferred

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We will determine the tag type during production. If you have specific tag type preferences, please inform us and we will prioritize development accordingly.
Synonyms
SPAC688.16; Uncharacterized membrane protein C688.16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC688.16
Target Protein Sequence
MSCLNLHVPKNPVGKYIPLVVLLQMYIIYVEPYYGLHYFESVRQFLGPKILYGTVYFLVI CHSIESAIAFLLCLKKGLPFCSSMKWIVSTFIFGGPTLAMLNKQKKHIA
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SPAC688.16 and why is it classified as a "sequence orphan"?

SPAC688.16 is a protein-coding gene in Schizosaccharomyces pombe (fission yeast) encoding an uncharacterized membrane protein of 109 amino acids. It is classified as a "sequence orphan" because it lacks significant sequence homology to proteins with known functions in other organisms .

The gene has the following identifiers:

Gene SymbolSPAC688.16
Entrez Gene ID9406951
Full Namesequence orphan/Uncharacterized membrane protein C688.16
Gene Typeprotein-coding
OrganismSchizosaccharomyces pombe (fission yeast)
UniProt IDC6Y4A4

Sequence orphans represent an important category of genes whose functions remain to be discovered, potentially revealing novel biological mechanisms specific to fission yeast or conserved processes that have diverged significantly at the sequence level.

What expression systems are appropriate for producing recombinant SPAC688.16 protein?

For recombinant expression of SPAC688.16, several systems have been documented:

For controlled expression levels, researchers can utilize different promoters:

  • Inducible promoters: pnmt1, pnmt41, pnmt81, and purg1

  • Constitutive promoters of varying strengths for consistent expression

How can I verify successful expression and purification of recombinant SPAC688.16?

Verification of successful expression and purification requires multiple complementary techniques:

  • SDS-PAGE analysis: Use 15-20% gels appropriate for small proteins (~12 kDa untagged, ~14-15 kDa with His-tag). The protein should appear at the expected molecular weight .

  • Western blotting: Detection using either:

    • Anti-His antibodies (for tagged versions)

    • Custom antibodies raised against SPAC688.16-specific peptides

  • Mass spectrometry verification: Use MALDI-TOF or LC-MS/MS to confirm protein identity and sequence coverage .

  • Purity assessment: Greater than 90% purity can be achieved and verified by densitometry of SDS-PAGE gels .

For membrane proteins like SPAC688.16, additional considerations include:

  • Use of appropriate detergents during extraction and purification

  • Validation of proper folding through functional assays

  • Assessment of aggregation state through size exclusion chromatography

What experimental approaches can be used to elucidate the function of SPAC688.16?

As an uncharacterized membrane protein, multiple complementary approaches should be employed:

  • Gene deletion and phenotypic analysis: Create SPAC688.16Δ strains and assess:

    • Growth under various conditions (temperature, nutrients, stressors)

    • Cell morphology and cell cycle progression

    • Response to specific membrane stressors

  • Localization studies:

    • C-terminal or N-terminal fluorescent protein tagging (GFP, mCherry)

    • Immunofluorescence microscopy with specific antibodies

    • Subcellular fractionation followed by Western blotting

  • Interactome analysis:

    • TAP-tag purification followed by mass spectrometry to identify binding partners

    • Yeast two-hybrid screening

    • Proximity labeling approaches (BioID or APEX)

  • Transcriptomic analysis:

    • RNA-seq comparing wild-type and SPAC688.16Δ strains

    • Analysis of SPAC688.16 expression under different conditions

  • Comparative genomics:

    • Identification of conserved regions or domains across related species

    • Analysis of evolutionary patterns to infer functional constraints

How can I investigate if SPAC688.16 plays a role in cellular stress responses?

Given that many membrane proteins are involved in stress responses, a systematic approach involves:

  • Stress response profiling:

    • Subject SPAC688.16Δ and wild-type strains to various stressors:

      • Oxidative stress (H₂O₂, menadione)

      • Cell wall stress (calcofluor white, congo red)

      • Osmotic stress (high salt, sorbitol)

      • Metal stress (copper, iron starvation/excess)

      • ER stress inducers (tunicamycin, DTT)

  • Transcriptional regulation analysis:

    • Quantify SPAC688.16 mRNA levels under stress conditions using RT-qPCR

    • Identify potential transcription factor binding sites in the promoter

  • Protein stability and modification:

    • Assess protein levels and potential post-translational modifications under stress

    • Use cycloheximide chase experiments to determine protein half-life during stress

  • Redox state analysis:

    • If SPAC688.16 contains cysteine residues (it has several), investigate potential redox regulation

    • Use redox-sensitive GFP fusion (roGFP2) for in vivo monitoring

What are the most effective strategies for creating SPAC688.16 gene modifications in S. pombe?

For precise genetic manipulation of SPAC688.16, several approaches are recommended:

  • Stable Integration Vector (SIV) system:

    • Use vectors like pUra4 AfeI for stable integration without tandem duplications

    • This approach prevents the genomic instability associated with traditional integration vectors

    • Integration efficiency can reach >95% with minimal false positives

  • CRISPR-Cas9 system for S. pombe:

    • Enables precise gene editing without selection markers

    • Can introduce point mutations or small insertions/deletions

  • Homologous recombination with flanking sequences:

    • Design constructs with 500-1000 bp homology arms flanking the SPAC688.16 locus

    • For tagging approaches, C-terminal tagging is preferable unless N-terminal sequence is non-essential

  • Promoter replacement strategies:

    • For controlled expression, replace native promoter with regulatable promoters

    • nmt1 (strong), nmt41 (medium), or nmt81 (weak) promoters enable thiamine-repressible expression

Verification of genomic modifications should include:

  • PCR confirmation using primers outside the integration site

  • Sequencing to ensure no unintended mutations

  • Expression verification by Western blot or RT-qPCR

How can I design experiments to determine if SPAC688.16 is essential for cell viability?

Determining essentiality requires careful experimental design:

  • Conditional expression systems:

    • Replace the native promoter with a regulatable promoter (nmt1 or urg1)

    • Assess growth in repressive vs. inductive conditions

    • Monitor cellular phenotypes during protein depletion

  • Diploid-based approach:

    • Delete one copy of SPAC688.16 in a diploid strain

    • Induce sporulation and analyze tetrad dissection results

    • A 2:2 segregation of viable:inviable spores suggests essentiality

  • Complementation testing:

    • Create a strain with an integrated second copy of SPAC688.16 under a different promoter

    • Attempt deletion of the native locus

    • If deletion is only possible with the complementing copy, the gene is essential

  • Transcriptomic response to depletion:

    • Analyze global gene expression changes during SPAC688.16 depletion

    • Significant cell wall remodeling processes may be observed if the protein is involved in cell wall integrity

What statistical approaches are most appropriate for analyzing phenotypic data from SPAC688.16 mutant studies?

When analyzing phenotypic data from SPAC688.16 experiments, appropriate statistical methods are crucial:

Remember to avoid arbitrary p-value thresholds and focus on effect sizes and biological significance when interpreting results .

How can I design experiments to investigate potential relationships between SPAC688.16 and cellular iron homeostasis?

Based on potential connections to membrane functions that might involve metal homeostasis , a systematic experimental design would include:

  • Transcriptional response analysis:

    • Compare SPAC688.16 mRNA levels under iron starvation versus iron-replete conditions

    • Analyze presence of iron-responsive elements (Fep1-binding sites) in the SPAC688.16 promoter

    • Include positive controls of known iron-regulated genes

  • Phenotypic characterization:

    • Compare growth of wild-type and SPAC688.16Δ strains under varying iron concentrations

    • Analyze cellular iron content using colorimetric assays or ICP-MS

    • Assess sensitivity to iron chelators and iron overload

  • Protein interaction studies:

    • Test for interactions with known iron transport and regulatory proteins

    • Investigate co-localization with iron transporters or storage proteins

    • Perform pull-down experiments under different iron conditions

  • Statistical design considerations:

    • Use factorial design to investigate interactions between genotype and iron conditions

    • Include temporal analysis to capture dynamic responses

    • Apply appropriate transformation for non-normally distributed data

  • Validating findings:

    • Perform genetic complementation using the wild-type SPAC688.16 gene

    • Create specific point mutations to identify critical residues

    • Compare results with known iron homeostasis mutants as benchmarks

How can I investigate the membrane topology and subcellular localization of SPAC688.16?

Determining membrane topology and localization requires specialized approaches:

  • Protease protection assays:

    • Spheroplast preparation for controlled membrane access

    • Treat with proteinase K with/without membrane permeabilization

    • Western blot analysis to determine protected regions

  • Fluorescent protein fusion approaches:

    • Create N- and C-terminal GFP fusions

    • Generate internal fusions at predicted loop regions

    • Live-cell imaging to determine subcellular localization and dynamics

  • Epitope tagging strategy:

    • Insert small epitope tags (HA, Myc, FLAG) at different positions

    • Perform immunofluorescence with/without membrane permeabilization

    • Accessibility of epitopes indicates topology orientation

  • Cell fractionation and biochemical verification:

    • Separate different cellular compartments (plasma membrane, ER, Golgi, etc.)

    • Identify SPAC688.16 distribution via Western blotting

    • Use appropriate marker proteins to validate fractionation purity

  • Mass spectrometry-based topology mapping:

    • Use membrane-impermeable labeling reagents to modify exposed residues

    • Analyze modification patterns by mass spectrometry

    • Compare experimental results with topology prediction algorithms

What methods can be used to investigate potential post-translational modifications of SPAC688.16?

For comprehensive analysis of post-translational modifications (PTMs):

  • Mass spectrometry-based approaches:

    • Immunoprecipitate tagged SPAC688.16 from S. pombe

    • Perform tryptic digestion and LC-MS/MS analysis

    • Use specialized search algorithms to identify PTMs

  • Phosphorylation analysis:

    • Use Phos-tag SDS-PAGE to detect phosphorylated forms

    • Apply λ-phosphatase treatment to confirm phosphorylation

    • Identify potential kinases through pharmacological inhibitors or genetic approaches

  • Glycosylation assessment:

    • Treat purified protein with EndoH and analyze mobility shifts

    • Use lectins to probe for specific glycan structures

    • Compare glycosylation patterns in different subcellular compartments

  • Ubiquitination and SUMOylation:

    • Create strains expressing tagged ubiquitin or SUMO

    • Immunoprecipitate SPAC688.16 and probe for modification

    • Identify potential interaction with deubiquitinating enzymes

  • Site-directed mutagenesis validation:

    • Mutate potential modification sites (serine/threonine for phosphorylation, lysine for ubiquitination)

    • Assess functional consequences of preventing modifications

    • Compare protein stability and localization of wild-type vs. mutant forms

How can I analyze the transcriptional regulation of SPAC688.16 under different experimental conditions?

To comprehensively characterize SPAC688.16 transcriptional regulation:

  • Promoter region analysis:

    • Identify potential transcription factor binding sites using bioinformatic tools

    • Look for motifs related to stress response (such as CESR), cell cycle regulation, or metal homeostasis

    • Compare with promoters of genes showing similar expression patterns

  • Reporter gene assays:

    • Clone the SPAC688.16 promoter upstream of a reporter gene (GFP, luciferase)

    • Analyze reporter expression under different conditions

    • Create promoter deletions to identify critical regulatory regions

  • Chromatin immunoprecipitation (ChIP):

    • Perform ChIP for suspected transcription factors that might regulate SPAC688.16

    • Common regulators to investigate might include:

      • Stress-responsive factors (Atf1, Pap1)

      • Cell cycle regulators (Cdc10, Fkh2)

      • Metal-responsive factors (Fep1, Cuf1)

  • Transcriptomic analysis across conditions:

    • Use microarray or RNA-seq to profile SPAC688.16 expression

    • Common conditions to test include:

      • Cell cycle phases

      • Nutrient limitation

      • Stress responses

      • Metal availability variations

  • Verification by quantitative PCR:

    • Design specific primers for SPAC688.16

    • Use RT-qPCR to validate expression changes

    • Include appropriate reference genes for normalization

How does transcriptional profiling data from SPAC688.16Δ mutants inform functional hypotheses?

Transcriptomic data from deletion mutants provides valuable insights:

  • Global expression changes:

    • Identify genes up- or down-regulated in SPAC688.16Δ compared to wild-type

    • Apply Gene Ontology (GO) enrichment analysis to identify affected biological processes

    • Previous studies suggest SPAC688.16 depletion may induce significant cell wall remodeling processes

  • Co-expression network analysis:

    • Construct gene networks from transcriptomic data

    • Position SPAC688.16 within functional modules

    • Identify hub genes that might interact functionally with SPAC688.16

  • Comparative analysis with known mutants:

    • Compare expression profiles with mutants of known function

    • Similar profiles may suggest shared pathways or cellular processes

    • Focus on comparison with other membrane protein mutants

  • Integration with protein interaction data:

    • Combine transcriptional networks with protein-protein interaction data

    • Identify physical interactions that correlate with transcriptional relationships

    • Build integrated models of function based on multiple data types

  • Validation experiments:

    • Select key differentially expressed genes for further analysis

    • Perform double mutant analysis to test genetic interactions

    • Use epistasis tests to establish pathway relationships

How can I design screens to identify genetic interactions of SPAC688.16?

To systematically identify genetic interactions:

  • Synthetic genetic array (SGA) analysis:

    • Cross SPAC688.16Δ strain with a deletion library or mutant collection

    • Score colony size/growth to identify synthetic lethal or sick interactions

    • Use appropriate statistical methods to identify significant interactions

  • Targeted genetic interaction testing:

    • Based on hypotheses about function, test specific double mutants

    • Focus on genes involved in:

      • Membrane organization

      • Secretory pathway

      • Cell wall integrity

      • Stress response pathways

  • Suppressor screening:

    • Identify mutations that suppress defects of SPAC688.16Δ

    • Use plasmid libraries or random mutagenesis approaches

    • Sequence suppressors to identify functional relationships

  • Chemical-genetic profiling:

    • Test sensitivity/resistance of SPAC688.16Δ to a panel of compounds

    • Compare profiles with known mutants

    • Identify compounds that specifically affect SPAC688.16Δ for mechanistic studies

  • Quantitative analysis methods:

    • Use appropriate statistical models to assess genetic interactions

    • Calculate genetic interaction scores based on expected vs. observed phenotypes

    • Cluster mutants based on similarity of genetic interaction profiles

How can I investigate if SPAC688.16 functions in meiosis or recombination in S. pombe?

To explore potential meiotic functions, which are significant in S. pombe research :

  • Meiotic induction experiments:

    • Compare wild-type and SPAC688.16Δ strains during nitrogen starvation-induced meiosis

    • Monitor key meiotic events:

      • DNA replication

      • Chromosome segregation

      • Spore formation

  • Recombination analysis:

    • Measure recombination frequencies using genetic markers on chromosome arms

    • Compare crossover and gene conversion rates between wild-type and mutant

    • Assess homologous recombination in mitotic cells using site-specific assays

  • Cytological analysis:

    • Immunostain for meiotic markers (Rec8, Rad51)

    • Visualize chromosome dynamics during meiotic prophase

    • Assess formation of recombination intermediates

  • Gene expression during meiosis:

    • Analyze SPAC688.16 expression during meiotic progression

    • Compare with known meiotic genes to identify potential co-regulation

    • Look for meiosis-specific transcription factor binding sites in the promoter

  • Physical monitoring of recombination:

    • Use Southern blotting to detect recombination intermediates

    • Quantify DSB formation and repair kinetics

    • Apply chromatin immunoprecipitation to assess protein recruitment to recombination hotspots

The integration of these approaches would provide comprehensive insights into any potential roles of SPAC688.16 in meiosis and recombination in S. pombe.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.