Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C977.01/C1348.02/PB2B2.19c (SPAC977.01)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Target Names
SPAC977.01
Target Protein Sequence
MIDFVKSRDTVIQKSFFEEFNSQNREMGSFAYSGNSESVWTGENITSIWKTILINETGSY CVAARPMTMDGAEFNLDLMGYSVSEDQINNDEIGIWNYISVAEMGGVLLFLSYWIWTCLH FSKIIFPAQKVICLYIFLFALNQTLQECIEEYVFSSECIKYRQFYSVYEIIDFLRTNFYR LFVIYCALGFGITRTVPKYLMIKGISIVIALCSVYWISLYKDVYVVSEIFDMIQYEVSPA IWVYSICHLLKQCTSVTTYENASKARFFRRMLNAFIFIFCASPMLHYLSNIIFGNFDYRL SVIIGDLFTFMEKIAFPCYIMFPTHNEALAYNRNVAEEAQEKMI
Uniprot No.

Q&A

How does SPAC977.01 relate to other membrane proteins in S. pombe?

SPAC977.01 belongs to a specific class of membrane proteins in S. pombe that are involved in cellular transport processes. While the exact function remains uncharacterized, comparative genomic analysis suggests potential roles in stress response mechanisms. The gene has multiple ORF names (SPAC977.01, SPAC1348.02, SPBPB2B2.19c), indicating possible gene duplication or annotation refinements throughout the history of S. pombe genomics .

When examining gene expression patterns in S. pombe, SPAC977.01 shows expression patterns that correlate with other transport proteins. According to microarray analysis data, several transport genes including SPAC977.17 are regulated under specific cellular conditions, suggesting functional relationships in transport mechanisms . The membrane localization and sequence characteristics place this protein in transport-related protein families that respond to environmental stressors.

What expression systems are most effective for producing recombinant SPAC977.01 protein?

For optimal expression of recombinant SPAC977.01, a strategic approach combining appropriate expression vectors and host systems is essential. While E. coli remains a cost-effective system for initial expression trials, membrane proteins often require eukaryotic expression systems for proper folding and post-translational modifications.

A methodological approach should include:

  • Vector selection: Use vectors with strong, inducible promoters (T7, tac) for controlled expression

  • Host optimization: Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3)) specifically engineered for membrane protein expression

  • Expression conditions: Optimize temperature (typically 16-25°C), inducer concentration, and expression duration to maximize yield while maintaining protein solubility

For challenging membrane proteins like SPAC977.01, protocols yielding 14-25 mg of NMR triple-labeled proteins from 50-mL cultures have been demonstrated without requiring fermentation equipment . This approach can be adapted specifically for SPAC977.01 expression.

Expression in the native S. pombe system may provide advantages for proper folding and function, particularly for confirming physiological interactions with other S. pombe proteins like those in the Rho GTPase signaling pathways .

What purification strategies should be employed for isolating functional SPAC977.01?

Purification of membrane proteins requires specialized approaches to maintain protein stability and function:

  • Membrane extraction: Employ a stepwise solubilization process using mild detergents (DDM, LMNG, or digitonin) to extract the protein while preserving its native conformation

  • Affinity chromatography: Utilize the fusion tag present on the recombinant protein (as indicated in the product specifications) for initial capture

  • Size exclusion chromatography: Remove aggregates and ensure monodispersity of the protein-detergent complex

  • Buffer optimization: Identify stabilizing conditions through thermal shift assays with various buffers, pH values, and additives

The specific storage buffer containing Tris-based buffer with 50% glycerol has been optimized for this protein . For downstream applications requiring detergent removal, consider reconstitution into nanodiscs or liposomes to maintain a membrane-like environment.

What techniques are most appropriate for determining the membrane topology of SPAC977.01?

Determining membrane protein topology requires a multi-method approach to generate a comprehensive structural model:

  • Computational prediction: Initial topology models can be generated using algorithms like TMHMM, MEMSAT, and TOPCONS which predict transmembrane segments based on hydrophobicity patterns

  • Biochemical mapping:

    • Cysteine scanning mutagenesis with membrane-impermeable labeling reagents

    • Glycosylation mapping using engineered N-glycosylation sites

    • Limited proteolysis combined with mass spectrometry

  • Structural biology approaches:

    • Cryo-electron microscopy for high-resolution structural determination

    • NMR spectroscopy for dynamic studies (using the triple-labeled protein preparation protocols mentioned )

    • X-ray crystallography if diffracting crystals can be obtained

  • Fluorescence-based techniques:

    • FRET analysis with strategically placed fluorophores

    • Fluorescence quenching to determine solvent accessibility

Each method provides complementary information, and their integration is necessary for developing an accurate topological model of this uncharacterized membrane protein.

How can researchers investigate potential interactions between SPAC977.01 and Rho GTPase signaling pathways?

Based on known S. pombe signaling pathways, investigating SPAC977.01 interactions with Rho GTPases should follow these methodological steps:

  • Co-immunoprecipitation assays: Using tagged versions of SPAC977.01 and Rho proteins (rho1p, rho2p) to detect physical interactions. This approach has successfully identified interactions between Rho GTPases and other effectors in S. pombe

  • Yeast two-hybrid screening: Modified membrane yeast two-hybrid systems can detect interactions between membrane proteins and their binding partners

  • Genetic interaction studies: Construction of double mutants (SPAC977.01 deletion with rho1/rho2 temperature-sensitive mutants) to identify synthetic phenotypes suggesting functional relationships

  • Microscopy-based co-localization: Fluorescently tagged proteins can reveal spatial and temporal co-localization patterns during different cellular processes

  • Functional assays based on Rho-mediated processes: Monitor cell wall integrity, actin cytoskeleton organization, and polarized growth in strains with altered SPAC977.01 expression

The study of protein kinase C homologues (pck1p, pck2p) in S. pombe has demonstrated that these proteins interact with rho1p and rho2p when bound to GTP. Similar interaction studies could be performed with SPAC977.01 to determine if it functions within the same signaling network .

How is SPAC977.01 gene expression regulated during different stress conditions?

Analysis of SPAC977.01 expression patterns should follow an experimental design that systematically tests the protein's response to various stressors. Based on established protocols for studying S. pombe gene regulation:

  • Design an experimental treatment matrix:

Stress ConditionDurationMeasurement Method
Oxidative stress (H₂O₂, menadione)15, 30, 60 minRT-qPCR, RNA-seq
Osmotic stress (sorbitol, NaCl)15, 30, 60 minRT-qPCR, RNA-seq
Nutrient limitation1, 3, 5 daysRT-qPCR, RNA-seq
Temperature stress15, 30, 60 minRT-qPCR, RNA-seq
pH stress15, 30, 60 minRT-qPCR, RNA-seq
  • Control extraneous variables that might influence results, including cell density, growth phase, and media composition

  • Compare expression patterns with known stress-responsive genes like those identified in the transport category (SPAC977.17, bsu1, mfs1)

  • Identify transcription factors potentially regulating SPAC977.01 through promoter analysis and chromatin immunoprecipitation

Research on other S. pombe genes has revealed that transport-related genes often show coordinated expression during stress responses, which could provide context for understanding SPAC977.01 regulation .

What is the relationship between SPAC977.01 expression and metabolic changes during stationary phase?

To investigate the relationship between SPAC977.01 and metabolic adaptation during stationary phase, researchers should design experiments examining:

  • Expression profiling: Compare SPAC977.01 transcript and protein levels across growth phases with particular attention to the transition to stationary phase

  • Metabolic analysis: Measure key metabolic indicators including:

    • Glucose consumption rates

    • Pyruvate metabolism (particularly relevant given the connection to pyruvate decarboxylases in S. pombe stationary phase adaptation)

    • Respiration rates

    • ATP/ADP ratios

  • Comparative analysis with Phx1-dependent genes: Since Phx1 has been identified as a regulator controlling long-term survival in S. pombe through metabolic reprogramming, investigate whether SPAC977.01 is regulated in a Phx1-dependent manner

  • Phenotypic characterization: Compare viability, stress resistance, and metabolic profiles between wild-type and SPAC977.01 deletion strains during stationary phase

Studies have shown that S. pombe undergoes significant metabolic reprogramming during stationary phase, including changes in carbohydrate metabolism genes. The regulation of these processes involves the transcription factor Phx1, which affects expression of multiple genes including several membrane transporters .

How can CRISPR-Cas9 genome editing be optimized for studying SPAC977.01 function in S. pombe?

CRISPR-Cas9 genome editing for SPAC977.01 functional studies requires careful optimization:

  • gRNA design:

    • Select target sites with minimal off-target effects using S. pombe-specific prediction tools

    • Design multiple gRNAs targeting different regions of the gene

    • Include controls targeting non-essential regions

  • Donor template design:

    • For knock-in studies, include appropriate homology arms (500-1000bp)

    • Design templates for various modifications: epitope tags, fluorescent proteins, point mutations

    • Include selection markers for efficient screening

  • Delivery method optimization:

    • Compare transformation efficiency between lithium acetate, electroporation, and polyethylene glycol methods

    • Optimize Cas9 and gRNA expression using appropriate S. pombe promoters

    • Consider ribonucleoprotein complex delivery for transient expression

  • Phenotypic validation:

    • Comprehensive characterization of edited strains

    • Compare growth rates, stress sensitivity, and membrane integrity

    • Assess potential off-target effects through whole-genome sequencing

The experimental design should include appropriate controls and validation methods to ensure the observed phenotypes are specifically related to SPAC977.01 modification .

What approaches can resolve contradictory data regarding SPAC977.01 function in different experimental contexts?

When facing contradictory experimental results regarding SPAC977.01 function, implement these resolution strategies:

  • Systematic review of methodological variations:

    • Create a comprehensive comparison table of experimental conditions

    • Identify critical variables that differ between studies (strain backgrounds, growth conditions, assay methods)

    • Design controlled experiments specifically addressing these variables

  • Multi-method validation approach:

    • Apply complementary techniques to address the same question

    • For protein-protein interactions: combine co-immunoprecipitation, proximity labeling, and functional assays

    • For localization studies: use both fluorescence microscopy and biochemical fractionation

  • Genetic background considerations:

    • Test hypotheses in multiple S. pombe strain backgrounds

    • Create a standardized genetic background for all experiments

    • Consider the impact of suppressor mutations that may mask phenotypes

  • Environmental condition matrix:

    • Systematically test function across diverse conditions (temperature, pH, osmolarity, nutrient availability)

    • Identify condition-specific functions that may explain seemingly contradictory results

  • Quantitative rather than qualitative assessment:

    • Develop quantitative assays with appropriate statistical analysis

    • Replace binary outcomes with continuous measurements where possible

    • Establish clear thresholds for biological significance

This systematic approach aligns with experimental design principles that emphasize controlling extraneous variables and ensuring reproducibility .

What are the optimal conditions for storing and handling recombinant SPAC977.01 protein to maintain stability and function?

Proper storage and handling of recombinant SPAC977.01 is critical for maintaining its structural integrity and functional activity:

  • Short-term storage (1-7 days):

    • Store working aliquots at 4°C

    • Use the optimized Tris-based buffer with 50% glycerol as specified in product information

    • Avoid repeated freeze-thaw cycles

  • Long-term storage:

    • Store at -20°C for standard storage

    • For extended storage periods, maintain at -80°C

    • Prepare small single-use aliquots to avoid repeated freeze-thaw cycles

  • Handling considerations:

    • Always keep the protein on ice during experiments

    • When diluting from glycerol stocks, use pre-chilled buffers

    • Consider adding protease inhibitors to prevent degradation

    • Monitor protein stability using analytical size exclusion chromatography

  • Functional preservation:

    • For functional studies, reconstitute in appropriate membrane mimetics (nanodiscs, liposomes)

    • Verify protein integrity before experiments using SDS-PAGE or Western blotting

    • Develop activity assays to confirm functional preservation

Following these guidelines will maximize protein stability and ensure reproducible experimental results across different studies and time points .

What controls and validation steps are essential when studying SPAC977.01 localization and trafficking in S. pombe cells?

A robust experimental design for studying SPAC977.01 localization and trafficking requires comprehensive controls and validation:

  • Epitope tag controls:

    • Compare multiple tag positions (N-terminal, C-terminal, internal tags)

    • Verify that tagged constructs complement deletion phenotypes

    • Include untagged controls and cells expressing only the fluorescent tag

  • Microscopy validation:

    • Use both live-cell imaging and fixed cell approaches

    • Employ super-resolution techniques for detailed localization

    • Include co-localization with established organelle markers

    • Implement quantitative image analysis rather than qualitative assessment

  • Biochemical validation:

    • Perform subcellular fractionation to confirm microscopy results

    • Use surface biotinylation assays to confirm plasma membrane localization

    • Implement protease protection assays to determine topology

  • Trafficking studies:

    • Employ temperature-sensitive trafficking mutants to trap proteins in specific compartments

    • Use synchronized cells to track protein movement during the cell cycle

    • Implement photoactivatable or photoconvertible tags for pulse-chase studies

  • Physiological relevance:

    • Verify localization under various stress conditions

    • Compare localization patterns in different growth phases

    • Analyze the impact of interacting proteins on localization

These methodological approaches align with established experimental design principles that emphasize controlling variables and implementing appropriate validation steps .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.