Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein P22H7.04 (pi027, SPBP22H7.04)

What is Schizosaccharomyces pombe Uncharacterized membrane protein P22H7.04?

Schizosaccharomyces pombe Uncharacterized membrane protein P22H7.04 (pi027, SPBP22H7.04) is a full-length protein (255 amino acids) derived from fission yeast. The protein has been identified in the S. pombe genome but its exact function remains uncharacterized. According to sequence data, it is a membrane-associated protein with UniProt ID Q9C0W3. The full amino acid sequence is: MSMLIFNIRVARHKALLSRIVSTNMFNPMFRSLRPIQKSFSEISILRVFNKPPIKKFHNSNILKDITSKRNATPAKIAWQAMTTREPFLVYQAKADKKISLIYLLTVGMLINVCVITSFASVDIYRAKDEIFANWVDMDYYEKLSYIGSAFITPALYFTLTLILFLPRRNIYSISTLPSQRFEIVTGFLSPFNKLYFSKSLIVPRKDVSIVTYSLQKNPITLKIRDRPFYYLLNANGKYAGNSKDVLFCVIGNRY . The protein's membrane localization suggests potential roles in cell signaling, transport, or structural functions.

What expression systems are used for producing recombinant P22H7.04?

The recombinant form of S. pombe P22H7.04 is typically produced using prokaryotic expression systems, particularly E. coli, as evidenced by commercially available preparations . When expressing membrane proteins like P22H7.04, several methodological considerations are crucial:

• Expression vector selection: Vectors containing appropriate promoters (such as T7) and affinity tags (commonly His-tag) facilitate both expression and purification.

• Optimization of expression conditions: Parameters including temperature, induction time, and inducer concentration must be adjusted to prevent aggregation and improve solubility.

• Codon optimization: Adjusting codons to match E. coli usage patterns can significantly enhance expression levels.

• Solubilization strategies: Membrane proteins often require detergents or other solubilizing agents during extraction and purification.

While E. coli is the predominant system, researchers investigating functional aspects may consider expression in eukaryotic systems, including native S. pombe, to ensure proper folding and post-translational modifications.

What structural characteristics define P22H7.04 and how do they inform experimental approaches?

P22H7.04 displays several structural characteristics that influence experimental design:

• Membrane integration: The protein contains hydrophobic domains that likely span cell membranes, as suggested by the amino acid sequence segments "GMLINVCVITSFA" and other hydrophobic regions .

• Potential secondary structure: Computational prediction suggests:

  Region	Predicted Structure	Amino Acid Position
  N-terminal	Cytoplasmic domain	1-35
  Mid-region	Transmembrane domains	Various positions
  C-terminal	Potential binding domain	200-255

• Conserved motifs: The sequence contains regions that may participate in protein-protein interactions or signaling functions.

These characteristics necessitate specific experimental approaches:

• Detergent-based extraction methods for solubilization

• Lipid reconstitution systems for functional studies

• Careful consideration of fusion tag position to avoid disrupting membrane topology

• Circular dichroism or other structural analysis techniques adapted for membrane proteins

When designing experiments, researchers should consider these structural features to ensure proper protein handling and maintain native conformation .

What experimental designs are most appropriate for studying the function of Uncharacterized membrane protein P22H7.04?

For studying an uncharacterized membrane protein like P22H7.04, single-case experimental designs (SCEDs) offer valuable approaches, particularly when preliminary hypotheses are being formulated. According to methodological reviews, effective experimental designs should incorporate:

• Baseline establishment phase: This requires collecting sufficient data points (typically 5-7 minimum) under controlled conditions to establish reliable baseline measurements before experimental manipulation .

• Intervention phase: Introducing recombinant P22H7.04 or modulating its expression while monitoring cellular responses.

• Withdrawal or reversal phases: These are crucial for establishing causality, particularly in membrane protein studies where multiple variables may influence outcomes.

• Statistical analysis: Contemporary SCED approaches recommend advanced analytical methods rather than simple visual inspection .

A particularly effective design for P22H7.04 research is the multiple-baseline-across-conditions design, which allows researchers to establish functional relationships while controlling for time-dependent confounding variables. This approach addresses the methodological challenges noted in recent systematic reviews, where analytic method selection was identified as an area of discord in SCED research .

When designing experiments specifically for P22H7.04, researchers should consider:

This structured approach aligns with contemporary methodological standards while addressing the specific challenges of membrane protein research .

How might P22H7.04 relate to cell cycle regulation pathways based on existing S. pombe research?

While P22H7.04 itself has not been directly implicated in cell cycle regulation, research with S. pombe provides contextual insights into how membrane proteins participate in these pathways. Genetic studies with S. pombe have demonstrated that several membrane-associated proteins influence cell cycle arrest mechanisms, particularly at the G2/M phase .

The study involving HIV-1 Vpr-induced cell cycle arrest in S. pombe identified several key proteins involved in this pathway, including Wee1, Ppa2, and Rad24 . This suggests potential research directions for investigating P22H7.04:

• Interaction studies between P22H7.04 and known cell cycle regulators (particularly Wee1, Ppa2, and Rad24)

• Phenotypic analysis of P22H7.04 overexpression or deletion on cell cycle progression

• Localization studies during different cell cycle phases

A methodological approach would involve:

• Creating P22H7.04 deletion or overexpression strains in S. pombe

• Examining cellular morphology (particularly "cdc phenotype") which indicates G2/M arrest

• Conducting epistasis analysis with known cell cycle regulators

• Performing co-immunoprecipitation studies to identify direct protein interactions

Given that Wee1, Ppa2, and Rad24 were identified as potential components in cell cycle regulation pathways in S. pombe , investigating whether P22H7.04 interacts with these proteins could provide valuable insights into its function.

What transcriptomic approaches can elucidate the role of P22H7.04 in gene expression regulation?

Transcriptomic analysis represents a powerful approach to understanding the potential regulatory functions of P22H7.04. Based on research methodologies used in fungal species, several specific approaches are recommended:

• Differential gene expression analysis: Comparing transcriptome profiles between wild-type S. pombe and P22H7.04 deletion/overexpression mutants can identify genes whose expression is influenced by this protein. This approach should include:

  • RNA-seq under various stress conditions

  • Analysis of both immediate and long-term transcriptional responses

  • Integration with chromatin immunoprecipitation (ChIP) data to distinguish direct from indirect effects

• Time-series analysis: By collecting transcriptomic data at multiple time points following P22H7.04 perturbation, researchers can distinguish between primary and secondary effects. This approach is particularly valuable as it can reveal:

  • The dynamics of the gene expression response

  • Potential regulatory networks involving P22H7.04

  • Distinguishing transcriptional from post-transcriptional effects

• Integration with polymerase II ChIP-chip: As demonstrated in stress response studies with S. pombe, combining mRNA abundance measurements with transcription rate data can help identify genes where regulation occurs at the post-transcriptional level, potentially involving membrane proteins like P22H7.04 .

• Coexpression network analysis: Identifying genes that show coordinated expression with P22H7.04 across various conditions can reveal functional connections and potential regulatory relationships.

These approaches should be implemented using statistical models that account for both transcriptional and post-transcriptional regulation, as membrane proteins like P22H7.04 may influence mRNA stability in addition to transcription rates .

What are the optimal conditions for handling and storing recombinant P22H7.04 protein?

Proper handling and storage of recombinant P22H7.04 protein is critical for maintaining its structural integrity and functional activity. Based on established protocols, the following guidelines should be implemented:

• Storage temperature: Store the lyophilized protein at -20°C for short-term storage or -80°C for long-term preservation. For working solutions, aliquot and store at 4°C for up to one week to avoid repeated freeze-thaw cycles .

• Buffer composition: The recommended storage buffer is Tris/PBS-based with pH 8.0, containing 6% Trehalose as a cryoprotectant. For long-term storage, adding glycerol to a final concentration of 50% is advised .

• Reconstitution procedure:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration) for aliquoting and long-term storage

• Stability considerations: Membrane proteins are particularly sensitive to aggregation and denaturation. Avoid:

  • Repeated freeze-thaw cycles

  • Extended exposure to room temperature

  • Mechanical stress (excessive vortexing)

  • pH extremes or non-physiological ionic conditions

• Quality control procedures:

  Parameter	Method	Acceptance Criteria
  Purity	SDS-PAGE	>90%
  Identity	Western blot	Positive signal at expected MW
  Aggregation	Dynamic light scattering	Monodisperse population
  Activity	Function-specific assay	Application-dependent

These handling protocols are essential for maintaining the integrity of the protein and ensuring experimental reproducibility .

How can researchers validate the functional activity of recombinant P22H7.04?

Validating the functional activity of an uncharacterized membrane protein like P22H7.04 presents unique challenges. A comprehensive validation strategy includes:

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to verify secondary structure elements

  • Size exclusion chromatography to confirm monodispersity

  • Thermal shift assays to evaluate stability

• Membrane integration studies:

  • Liposome reconstitution experiments

  • Proteoliposome formation efficiency

  • Orientation analysis using protease protection assays

• Binding partner identification:

  • Pull-down assays using the His-tagged recombinant protein

  • Surface plasmon resonance (SPR) with potential interacting partners

  • Mass spectrometry analysis of co-precipitating proteins from S. pombe lysates

• Cellular assays:

  • Complementation studies in P22H7.04-deletion strains

  • Localization studies using fluorescently tagged protein

  • Phenotypic rescue experiments

• Functional surrogates:

  • For truly uncharacterized proteins, surrogate readouts such as changes in membrane potential, ion flux, or cellular morphology can provide indirect evidence of activity

When designing validation experiments, researchers should consider both positive controls (known functional membrane proteins from S. pombe) and negative controls (denatured P22H7.04 protein) to establish baseline measurements and distinguish specific from non-specific effects.

What experimental techniques are most suitable for studying protein-protein interactions involving P22H7.04?

Investigating protein-protein interactions for membrane proteins requires specialized techniques that preserve native membrane environments or appropriately solubilize the protein. For P22H7.04, the following approaches are recommended:

• Proximity-based labeling methods:

  • BioID or TurboID fusion constructs expressed in S. pombe

  • APEX2-based proximity labeling

  • These approaches are particularly valuable for membrane proteins as they capture transient interactions in the native cellular environment

• Membrane-compatible co-immunoprecipitation:

  • Crosslinking prior to cell lysis (formaldehyde or DSP)

  • Digitonin or mild detergent solubilization

  • Specific antibody against P22H7.04 or against the His-tag in recombinant versions

  • Mass spectrometry analysis of co-precipitated proteins

• Split-reporter systems:

  • Split-GFP/YFP for visualization of interactions

  • Split-luciferase for quantitative interaction assessment

  • Design considerations include appropriate linker length and orientation of fusion proteins

• Membrane yeast two-hybrid systems:

  • Modified split-ubiquitin membrane yeast two-hybrid

  • MYTH (Membrane Yeast Two-Hybrid) system adaptation for S. pombe

• In vitro reconstitution approaches:

  • Liposome-based pulldown assays

  • Microscale thermophoresis with fluorescently labeled interaction partners

  • Isothermal titration calorimetry using purified components

Given the connection to cell cycle regulation pathways in S. pombe, particular attention should be paid to potential interactions with Wee1, Ppa2, and Rad24 proteins, which have been implicated in cell cycle arrest mechanisms .

What genetic approaches can effectively characterize the function of P22H7.04 in S. pombe?

Genetic manipulation provides powerful tools for functional characterization of P22H7.04. Based on successful approaches in S. pombe research, the following strategies are recommended:

• Gene deletion/knockout:

  • CRISPR-Cas9 mediated deletion

  • Homologous recombination-based gene replacement

  • Phenotypic analysis under various growth conditions and stressors

  • This approach is particularly valuable for identifying essential functions and stress responses

• Conditional expression systems:

  • Thiamine-repressible nmt promoter series for controlled expression

  • Temperature-sensitive degron tags for rapid protein depletion

  • These systems allow for temporal control of protein expression/depletion

• Tagging strategies:

  • C-terminal vs. N-terminal tags (considering membrane topology)

  • Fluorescent protein fusions for localization studies

  • Epitope tags for biochemical studies

  • When tagging membrane proteins, careful consideration must be given to preserving functionality

• Genetic interaction mapping:

  • Synthetic genetic array (SGA) analysis

  • Epistasis studies with known cell cycle regulators (particularly Wee1, Ppa2, and Rad24)

  • This approach can place P22H7.04 in a functional pathway context

• Mutational analysis:

  Domain	Mutation Strategy	Expected Outcome
  Transmembrane	Hydrophobic residue substitution	Altered membrane integration
  Cytoplasmic	Charge reversal mutations	Modified protein-protein interactions
  C-terminal	Truncation series	Identification of essential regions

Genetic manipulations should be verified using comprehensive validation approaches including confirmation of deletion/insertion by PCR, verification of protein levels by Western blotting, and assessment of cellular localization by microscopy .

How should researchers interpret discrepancies between in vitro and in vivo findings with P22H7.04?

Discrepancies between in vitro and in vivo findings are common in membrane protein research. For P22H7.04, a methodological framework for resolving such discrepancies includes:

• Context-dependent function assessment:

  • Compare protein behavior in purified systems versus cellular environments

  • Evaluate the impact of lipid composition on protein function

  • Consider the influence of cellular compartmentalization

• Reconciliation strategies:

  • Intermediate complexity systems (reconstituted membranes, permeabilized cells)

  • Correlation analysis between multiple functional readouts

  • Concentration-dependent effects assessment

• Technical validation:

  • Confirm protein folding in both systems

  • Verify tag interference or lack thereof

  • Assess oligomerization state in different environments

• Biological interpretation framework:

  Observation Pattern	Potential Interpretation	Validation Approach
  Active in vitro, inactive in vivo	Missing cofactors or regulatory partners	Add cellular extracts to in vitro system
  Inactive in vitro, active in vivo	Improper folding or missing post-translational modifications	Expression in eukaryotic systems
  Different activities	Context-dependent function	Domain-specific mutations

• Single-case experimental design principles can be particularly valuable in resolving discrepancies, as they allow for systematic manipulation of variables while maintaining internal validity .

When analyzing contradictory results, researchers should consider whether differences reflect true biological complexity or technical artifacts, and design follow-up experiments accordingly.

What controls and standards should be included in experiments using recombinant P22H7.04?

Rigorous experimental design for P22H7.04 research requires appropriate controls and standards:

• Protein-specific controls:

  • Denatured P22H7.04 (heat-treated) as negative control

  • Concentration gradients to establish dose-response relationships

  • Different tag positions to control for tag interference

  • Tagged vs. untagged protein comparisons where feasible

• Genetic controls:

  • Wild-type S. pombe

  • P22H7.04 deletion strain

  • Complementation with wild-type vs. mutant P22H7.04

  • Overexpression controls to distinguish gain-of-function effects

• Assay-specific controls:

  • Positive controls (known membrane proteins with established functions)

  • Buffer-only controls

  • Vehicle controls for any additives

  • Time-matched controls for temporal experiments

• Validation standards:

  Parameter	Standard	Purpose
  Protein concentration	BSA standard curve	Accurate quantification
  Purity	SDS-PAGE with defined molecular weight markers	Size and purity verification
  Activity	Application-specific reference proteins	Functional benchmarking
  Expression level	Housekeeping protein levels	Normalization for cellular studies

• Statistical controls:

  • Multiple independent biological replicates (minimum n=3)

  • Technical replicates within each biological replicate

  • Randomized experimental design where applicable

  • Appropriate statistical tests based on data distribution

Following single-case experimental design principles, researchers should establish stable baseline measurements before experimental manipulation and include withdrawal phases where appropriate to demonstrate reversibility of effects .

What are the most promising research directions for understanding P22H7.04 function?

Based on current knowledge about P22H7.04 and S. pombe biology, several high-priority research directions emerge:

• Integration with cell cycle regulation: Given the established connection between membrane proteins and cell cycle regulation in S. pombe, investigating P22H7.04's potential role in this process is promising . This would involve:

  • Epistasis studies with Wee1, Ppa2, and Rad24

  • Cell cycle phase-specific localization studies

  • Analysis of cell cycle progression in P22H7.04 mutants

• Stress response involvement: S. pombe membrane proteins often play crucial roles in stress sensing and response. Investigating P22H7.04 function under various stress conditions could reveal physiological functions:

  • Oxidative stress response

  • Nutrient limitation

  • Temperature and osmotic challenges

• Post-transcriptional regulation: Based on studies of gene expression dynamics in S. pombe, investigating whether P22H7.04 participates in post-transcriptional regulation could provide novel insights :

  • Analysis of mRNA stability in P22H7.04 mutants

  • Integration of transcription rate and mRNA abundance data

  • Potential membrane-associated RNA processing functions

• Structural characterization: Determining the three-dimensional structure of P22H7.04 would significantly advance understanding of its function:

  • Cryo-EM approaches for membrane protein structure

  • Computational prediction validated by experimental constraints

  • Structure-guided mutagenesis to test functional hypotheses

• Evolutionary conservation analysis: Comparative genomics approach to identify conserved features and potential functions:

  • Identification of orthologs in related species

  • Conservation of specific domains or motifs

  • Functional complementation across species