Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein PB8E5.08 (SPAPB8E5.08)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant SPAPB8E5.08 is produced using Schizosaccharomyces pombe as the expression host. Key features include:

  • UniProt ID: Q9C0X7

  • Gene Name: SPAPB8E5.08 (systematic identifier)

  • Expression Region: Amino acids 1–103 (full-length protein)

  • Tag: Determined during production (typically polyhistidine or affinity tags for purification)

  • Molecular Weight: ~12 kDa (calculated from sequence)

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C for short-term or -80°C for long-term storage .

Functional Context in Schizosaccharomyces pombe

Although SPAPB8E5.08 lacks direct functional characterization, insights can be drawn from related studies on S. pombe membrane proteins:

  • Membrane Protein Classification: Membrane proteins in S. pombe are annotated based on transmembrane helices, lipid-binding regions, or association with membrane compartments (e.g., ER, Golgi) .

  • ER Morphology Regulation: Intramembrane proteases like signal peptide peptidase (SPP) modulate ER structure by degrading morphogenic proteins such as syntaxin-18 (STX18) . While SPAPB8E5.08 is not directly linked to SPP, such studies highlight the importance of membrane proteins in organelle dynamics.

  • Meiotic Recombination: Membrane-associated proteins in S. pombe often interact with DNA repair machinery (e.g., Dmc1, Rhp51) . SPAPB8E5.08’s membrane localization suggests potential indirect roles in stress responses or genome stability.

Applications and Research Utility

Recombinant SPAPB8E5.08 is primarily used for:

  • Antibody Production: As an immunogen for generating antibodies against uncharacterized membrane proteins.

  • Structural Studies: Its small size and solubility in Tris-glycerol buffers make it suitable for crystallography or NMR .

  • Functional Screens: Testing interactions with known membrane complexes (e.g., SNAREs, transporters) .

Current Limitations

  • Functional Data: No peer-reviewed studies directly investigate SPAPB8E5.08’s role.

  • Commercial Availability: Listed as "Not Available For Sale" by suppliers like CBM15 .

Comparative Analysis with Other S. pombe Proteins

FeatureSPAPB8E5.08Syntaxin-18 (STX18)Dmc1
FunctionUncharacterizedER membrane fusionMeiotic recombination
LocalizationMembraneER/GolgiNucleus
ExpressionConstitutiveConstitutiveMeiosis-specific
Proteolytic RegulationNone reportedSPP-mediated degradation N/A

Future Directions

Key research gaps include:

  • Interaction Partners: Identify binding proteins via yeast two-hybrid or co-immunoprecipitation.

  • Phenotypic Analysis: Knockout strains to assess growth defects under stress (e.g., oxidative, DNA damage) .

  • Subcellular Mapping: Localization studies using GFP tagging .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your desired format in the order remarks and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributor.
Note: Our standard shipping includes blue ice packs. If dry ice shipping is preferred, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing it.
Synonyms
SPAPB8E5.08; Uncharacterized membrane protein PB8E5.08
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAPB8E5.08
Target Protein Sequence
MRKLRCKQMIPKLLPFIFIYLSVANKIMFYCILNERAFKHYKTYRRITDCPEIKNKKSRR KNQRNSSSIGLSNPNKFSIYIYIYFFFYSFLCSPYLFKYISLF
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is known about the evolutionary conservation of SPAPB8E5.08 across Schizosaccharomyces species?

Understanding the evolutionary conservation of SPAPB8E5.08 requires comparative genomic analysis across the Schizosaccharomyces genus. To investigate this:

  • Perform sequence alignment of SPAPB8E5.08 against genomes of related species

  • Identify orthologous proteins in other Schizosaccharomyces species

  • Calculate sequence similarity percentages

  • Analyze conserved domains and motifs

Based on approaches used in similar S. pombe studies, approximately 95% of predicted peptides from divergent strains can align to reference proteins with >95% identity, indicating high conservation within the species . For identifying orthologs in related Schizosaccharomyces species, BLAST searches with e-value thresholds of 10^-20 are typically used to establish evolutionary relationships .

What are the key genetic considerations when selecting S. pombe strains for expression of SPAPB8E5.08?

When selecting S. pombe strains for SPAPB8E5.08 expression, consider:

  • Natural genetic variation between strains

  • Promoter compatibility and strength

  • Auxotrophic markers and selection systems

  • Genetic stability and copy number

Recent analyses of 161 S. pombe strains revealed considerable genetic differences between five connected clusters, with F_ST values (proportion of between-population genetic variance) ranging from 0.22 to 0.59 . This genetic diversity affects protein expression capabilities. For optimal expression, consider using strains with established success in membrane protein production, and evaluate integration into the leu1 locus, which has been successful for other recombinant proteins in S. pombe .

How does SPAPB8E5.08 compare to other uncharacterized membrane proteins in S. pombe?

To position SPAPB8E5.08 within the broader context of S. pombe membrane proteome:

  • Perform hydropathy analysis and transmembrane domain prediction

  • Compare conserved motifs with other membrane proteins

  • Analyze subcellular localization predictions

  • Assess potential relationships to characterized protein families

A comprehensive approach would mirror methods used in comparative proteome analyses of S. pombe, where global changes in protein expression levels are systematically documented and analyzed . When categorizing membrane proteins, key parameters include predicted transmembrane domains, localization signals, and conservation patterns across fungal species.

What are the optimal expression systems for recombinant production of SPAPB8E5.08 in S. pombe?

For effective expression of SPAPB8E5.08, consider these methodological approaches:

  • Promoter selection: The nmt1 promoter system offers strong, thiamine-regulatable expression for membrane proteins

  • Vector strategy: Both integrative vectors (e.g., pCAD1) and episomal vectors (e.g., pREP1) can be used in combination for enhanced expression

  • Codon optimization: Adapt codons to match S. pombe preferences

  • Integration locus: The leu1 locus provides stable expression

Based on comparative studies of S. pombe protein secretion, a dual approach combining chromosomal integration with episomal expression can significantly enhance protein yields, as demonstrated with the model protein maltase . For membrane proteins specifically, the nmt1 promoter allows for controlled induction and has been successfully used for challenging protein targets.

What methods are most effective for purification and solubilization of SPAPB8E5.08?

Purification of membrane proteins like SPAPB8E5.08 requires specialized approaches:

  • Detergent screening matrix:

Detergent ClassExamplesTypical CMC (%)Membrane Protein Compatibility
Non-ionicDDM, Triton X-1000.009-0.02High compatibility, milder
ZwitterionicCHAPS, LDAO0.1-0.5Medium compatibility
IonicSDS, Sarkosyl0.1-0.4Harsh, potentially denaturing
  • Cell disruption: High-pressure homogenization is preferred for yeast cells

  • Affinity tag selection: C-terminal tags often preserve membrane protein topology better than N-terminal tags

  • Optimal buffer conditions: Include glycerol (20-30%) for stability, as glycerol has been shown to maintain enzyme activity in S. pombe proteins

Based on established protocols for membrane proteins, a step gradient purification approach starting with crude membrane isolation followed by detergent solubilization screening is recommended. The presence of NaCl and glycerol in buffers significantly improves stability, as demonstrated with other S. pombe proteins that retain approximately 100% activity in the presence of 3M NaCl .

How can isotopic labeling be implemented for structural studies of SPAPB8E5.08?

For structural studies requiring isotopic labeling:

  • Minimal media formulation: Develop defined minimal media compatible with S. pombe growth

  • Carbon source substitution: Replace glucose with 13C-labeled sources

  • Nitrogen incorporation: Use 15N-ammonium salts for nitrogen labeling

  • Selective amino acid labeling: For specific residue labeling, use auxotrophic strains

Previous metabolic flux analysis studies in S. pombe using 13C-assisted methods provide a foundation for designing effective labeling protocols . For membrane proteins specifically, attention to media composition is critical as comparative proteome analysis has shown that precursor availability and membrane composition limit protein secretion in S. pombe .

What bioinformatic approaches can predict the structural features of SPAPB8E5.08?

Apply these computational methods to predict SPAPB8E5.08 structure:

  • Transmembrane topology prediction using multiple algorithms (TMHMM, Phobius, TOPCONS)

  • Secondary structure prediction (PSIPRED, JPred)

  • Homology modeling if distant homologs exist

  • Protein family classification (PFAM, InterPro)

Bioinformatic analysis should include identification of conserved motifs similar to the approach used for family VIII esterases, where catalytic residues were identified through sequence analysis and structural modeling . Look for conserved residues that might form catalytic triads or other functional motifs within predicted transmembrane domains or connecting loops.

What experimental approaches are most suitable for determining the cellular localization of SPAPB8E5.08?

To determine the cellular localization of SPAPB8E5.08:

  • Fluorescent protein fusion construction:

    • C-terminal GFP fusion using pREP1-GFP vector

    • Verification of fusion protein expression by Western blot

    • Live-cell imaging with colocalization markers

  • Subcellular fractionation protocol:

    • Differential centrifugation steps: 1,000g (nuclei), 10,000g (mitochondria), 100,000g (microsomes)

    • Western blot analysis of fractions using anti-tag antibodies

    • Marker proteins for compartment identification

  • Immunoelectron microscopy for high-resolution localization

For accurate interpretation, compare localization patterns under different growth conditions, as protein expression and localization in S. pombe can vary with environmental factors .

How can functional assays be designed to characterize the biochemical activity of SPAPB8E5.08?

Without known function, a systematic approach to functional characterization includes:

  • Substrate screening panel:

    • Lipid substrates (glyceryl tributyrate, glyceryl trioleate)

    • Natural oils (olive oil, fish oil)

    • Carbohydrate esters (glucose pentaacetate, cellulose acetate)

  • Activity assays:

    • pH indicator-based hydrolysis assays with phenol red

    • Rhodamine B-substrate fluorescence (500-600nm) after 350nm excitation

    • Radiolabeled substrate incorporation

  • Site-directed mutagenesis of predicted active site residues

The pH indicator-based hydrolysis assay successfully used for esterase characterization provides a model approach . For membrane proteins specifically, developing assays that work with detergent-solubilized protein or reconstituted proteoliposomes may be necessary.

How should quantitative proteomics data for SPAPB8E5.08 expression studies be analyzed?

For robust proteomics data analysis:

  • Sample preparation protocol:

    • Pooling scheme for multidimensional separation

    • Isobaric labeling (iTRAQ approach)

    • Global internal standard approach

  • Data analysis workflow:

    • Two-dimensional LC coupled offline to MALDI MS

    • Search against S. pombe protein database

    • Statistical validation and false discovery rate control

  • Quantification methods:

    • Relative quantification using isobaric tags

    • Absolute quantification with standard peptides if available

According to proteome analysis studies in S. pombe, this approach revealed changes in protein levels across numerous biological pathways, providing targets for genetic engineering to improve protein expression . For membrane proteins, additional considerations for hydrophobic peptide recovery and analysis should be implemented.

What statistical approaches are recommended for analyzing SPAPB8E5.08 functional assay data?

For rigorous statistical analysis of functional data:

  • Experimental design considerations:

    • Minimum of three biological replicates

    • Include appropriate positive and negative controls

    • Use randomized block design to minimize batch effects

  • Statistical tests based on data characteristics:

    • Parametric tests (t-test, ANOVA) for normally distributed data

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal data

    • Post-hoc tests (Tukey's HSD, Bonferroni) for multiple comparisons

  • Data normalization strategies specific to assay type

In comparative enzyme studies, statistical significance is typically determined through two-tailed t-tests after confirming data normality . Ensure experimental design meets the criteria outlined in research methodology best practices, including appropriate controls to evaluate reliability and validity .

How can phenotypic changes due to SPAPB8E5.08 deletion or overexpression be systematically analyzed?

For comprehensive phenotypic analysis:

  • Growth phenotype characterization:

    • Growth curves in different media compositions

    • Stress condition response profiling (osmotic, temperature, pH)

    • Carbon source utilization patterns

  • Microscopy-based morphological analysis:

    • Cell size and shape quantification

    • Cell cycle progression

    • Organelle morphology changes

  • Global effects assessment:

    • Transcriptome analysis (RNA-seq)

    • Metabolome profiling

    • Comparative proteome analysis with iTRAQ labeling

When analyzing phenotypic data, systematic approaches similar to those used in comparative proteome analysis will reveal global changes of protein expression levels in response to deletion or overexpression . This holistic approach provides insight into the cellular function of uncharacterized proteins.

What strategies address low expression yields of SPAPB8E5.08 in S. pombe?

To improve expression yields:

  • Optimization matrix:

ParameterOptions to TestExpected Impact
Promoter strengthnmt1, adh1, fbp1Variable expression levels
Media supplementationAmino acids, lipidsAddresses precursor limitations
Growth temperature25°C, 30°C, 32°CAffects protein folding efficiency
Induction timingEarly vs. late log phaseOptimizes cell physiology for expression
  • Host strain engineering approaches:

    • Overexpression of chaperones

    • Deletion of specific proteases

    • Modification of membrane composition

Studies on S. pombe have identified that precursor availability and membrane composition limit protein secretion, providing targets for optimization . Supplementing growth media with specific amino acids can address limitations in amino acid biosynthesis pathways identified through proteome analysis .

How can protein misfolding and aggregation of SPAPB8E5.08 be minimized?

To address misfolding and aggregation:

  • Temperature optimization: Lower growth temperatures (25°C) slow protein synthesis and may improve folding

  • Chemical chaperones: Addition of glycerol (up to 30%) or osmolytes to stabilize protein conformation

  • Expression system modifications: Use weaker promoters or inducible systems for controlled expression rates

  • Co-expression of molecular chaperones

Stability tests have shown that S. pombe proteins can retain approximately 100% and 70% of enzymatic activity in the presence of 3M NaCl and glycerol, respectively . These findings suggest that buffer optimization with these components may help prevent aggregation of membrane proteins like SPAPB8E5.08.

What are the critical considerations for ensuring reproducibility in SPAPB8E5.08 research?

To ensure research reproducibility:

  • Standardized methodology documentation:

    • Detailed protocols with all parameters specified

    • Clear reporting of strain construction methods

    • Complete description of growth conditions and media composition

  • Quality control measures:

    • Verification of strain genotype before each experiment

    • Protein integrity assessment by SDS-PAGE and Western blot

    • Periodic sequencing to confirm absence of mutations

  • Data management best practices:

    • Raw data preservation

    • Statistical analysis transparency

    • Sharing of materials and methods

Adherence to rigorous methodology documentation is essential, as outlined in research methodology guidelines . For genetic work with S. pombe, careful verification of integrations and plasmid maintenance is critical, as demonstrated in protocols for strain construction that include sequencing confirmation of all expression constructs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.