Recombinant Schizosaccharomyces pombe Uncharacterized metal transporter C16E9.14c (SPBC16E9.14c)

Shipped with Ice Packs
In Stock

Description

Introduction

The recombinant protein SPBC16E9.14c (Uniprot ID: O14329), also designated as zrg17+ in fission yeast (Schizosaccharomyces pombe), is an uncharacterized metal transporter belonging to the cation diffusion facilitator (CDF) family. While its precise function remains under investigation, emerging studies highlight its role in zinc homeostasis, Golgi membrane trafficking, and interactions with other CDF proteins. This article synthesizes molecular, functional, and research-derived insights into this protein, supported by experimental data and product specifications.

Zinc Transport and Golgi Localization

SPBC16E9.14c (Zrg17) forms a heteromeric complex with Cis4 (SPAC17D4.03c), another CDF protein localized to the cis-Golgi . This complex regulates zinc uptake into the Golgi, influencing membrane trafficking and secretion. Key findings include:

  • Zinc-Suppressible Phenotypes: Mutations in zrg17 or cis4 result in cell wall defects and impaired acid phosphatase secretion, reversible by extracellular Zn²⁺ supplementation .

  • Interaction and Localization: Zrg17 physically interacts with Cis4, suggesting coordinated zinc transport activity. Cis4’s cis-Golgi localization positions it to facilitate Zn²⁺ influx critical for organelle function .

Synthetic Lethality with Trafficking Mutants

Δcis4 and Δzrg17 mutants exhibit synthetic growth defects with membrane-trafficking mutants (e.g., ypt3-i5, apm1-1), indicating a link between zinc homeostasis and vesicle transport .

Comparative Analysis of CDF Proteins

FeatureSPBC16E9.14c (Zrg17)Cis4 (SPAC17D4.03c)Zhf1 (SPAC3G9.08c)
LocalizationGolgi (inferred) cis-Golgi ER membrane
Interacting PartnersCis4 Zrg17 None reported
FunctionZinc transport (Golgi) Zinc uptake (Golgi) Zinc storage/detox (ER)
Zn²⁺ SuppressionYes Yes No

Mechanistic Implications

  • Oligomeric Transport: Zrg17 and Cis4’s nonadditive phenotypes suggest they act as a functional heterodimer, a conserved mechanism in eukaryotic zinc transport .

  • Therapeutic Relevance: Defects in Golgi zinc homeostasis may underpin human diseases involving trafficking dysregulation (e.g., lysosomal storage disorders).

Recombinant Protein Details

AttributeValue
Product CodeCSB-EP521131SXV1
Expression Region1–386 amino acids
Shelf Life6 months (liquid, -20°C/-80°C); 12 months (lyophilized, -20°C/-80°C)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol

This recombinant protein serves as a critical tool for studying CDF-mediated zinc transport in S. pombe and related model systems.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
zrg17; SPBC16E9.14c; Probable zinc transporter zrg17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
zrg17
Target Protein Sequence
MTQNHNIPTAIQIQNPINNNVSVTISDQLPKPSANNPNLLSVDTRPTHRKGHHHKHSLSH QYFLPPKNRQPLEIPASYPIPTFKETFAILTFPQKLKLTSSILFFLVAVGVLLSGDATIL LTLSCSLIVEGVLIIINVWRETLDSFLVWRHTCLRYPFGMQQMELLVDFSFSILLIFLGM NLLKEPAEHAIEDWGNLHHAGDHEEETVHIHLTISLFASAIISGFALLLDHPSAHIRELN SRFFHGLTLVPSLILVLLLSLGYQVGSFLSHLLSLTIAVTALVNGFSIAKSLALMLLLTY SNKEKVFECVSLIKEDTRIDQLNYAAIWQPHYNTCIANIGLTVSGGEREQAAVREDIIRI IQKTVGSIFGAGVQPKWEISVDIQRA
Uniprot No.

Target Background

Function
This protein is a probable transporter involved in regulating zinc homeostasis.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cytoplasm. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is SPBC16E9.14c and how is it classified functionally?

SPBC16E9.14c is an uncharacterized metal transporter gene from the fission yeast Schizosaccharomyces pombe. It encodes a protein that belongs to the cation diffusion facilitator (CDF) family of metal transporters, which are structurally related to zinc transporters . The gene has been named zrg17+ based on its homology to the Saccharomyces cerevisiae Zrg17p protein (similarity score = 210, Expect = 1.2e−15) . The encoded protein has a UniProt accession number of O14329 and consists of 386 amino acids . Functionally, it appears to be involved in zinc transport and homeostasis within the cell, particularly at the Golgi membrane.

What is known about the expression and regulation of SPBC16E9.14c in S. pombe?

While specific expression data for SPBC16E9.14c is limited in the provided research, we can infer some regulatory patterns based on its functional homology to other CDF proteins. The protein appears to be constitutively expressed, as it plays a role in fundamental cellular processes related to membrane trafficking and zinc homeostasis . Unlike some other metal transporters such as those in the SLC39A family that are regulated by proinflammatory conditions (particularly increased interleukin-6 and nitric oxide), transcription factors AP-1, ATF4, and ATF6α , the specific regulatory mechanisms for SPBC16E9.14c have not been fully characterized. Research approaches to study its expression would include quantitative PCR, western blotting, and reporter gene assays under various conditions, particularly those that alter cellular zinc concentrations.

How does SPBC16E9.14c relate to other known metal transporters?

SPBC16E9.14c (zrg17+) shares functional similarities with other metal transporters, particularly those involved in zinc transport. It is homologous to the Saccharomyces cerevisiae Zrg17p protein and structurally belongs to the cation diffusion facilitator (CDF) family. In S. pombe, SPBC16E9.14c appears to interact physically with another CDF protein, Cis4, suggesting they may function together in metal transport processes .

This protein differs from the SLC39A (ZIP) family of transporters, which transport zinc, iron, and manganese ions across cellular membranes . While ZIP transporters generally move metals into the cytoplasm from either outside the cell or from organellar compartments, CDF transporters typically function in the opposite direction, moving metals out of the cytoplasm either into organelles or out of the cell. Understanding these functional and evolutionary relationships provides context for experimental design and interpretation of results in metal transport research.

What are the optimal conditions for handling and storing Recombinant SPBC16E9.14c protein?

The recombinant SPBC16E9.14c protein should be stored in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . For short-term storage (up to one week), the protein can be kept at 4°C as working aliquots. For longer-term storage, it should be maintained at -20°C, and for extended preservation, storage at -20°C or -80°C is recommended .

To minimize protein degradation, it's crucial to avoid repeated freeze-thaw cycles, as this can compromise protein integrity and activity . When working with the protein, researchers should prepare small aliquots for single use to prevent this issue. Additionally, when thawing, the protein should be gently mixed rather than vortexed to avoid denaturation. For experiments requiring precise concentration measurements, Bradford or BCA protein assays should be performed prior to experimental use, particularly after extended storage periods.

What methodologies are most effective for studying SPBC16E9.14c function in S. pombe?

Several complementary approaches are effective for investigating SPBC16E9.14c function:

  • Gene Knockout and Complementation: One-step gene disruption by homologous recombination can be performed to create SPBC16E9.14c knockout strains, similar to the methodology described for Cis4 . The resulting phenotypes can be analyzed, and complementation assays with wild-type or mutant versions of the gene can confirm specificity.

  • Localization Studies: Fluorescent protein tagging (e.g., GFP fusion) can determine the subcellular localization of SPBC16E9.14c, which would help confirm its suspected Golgi membrane localization based on its interaction with Cis4 .

  • Metal Transport Assays: Transport activity can be assessed using radioactive isotopes of zinc (65Zn), similar to methods used for studying other metal transporters . Measuring intracellular metal accumulation in wild-type versus mutant cells provides direct evidence of transport function.

  • Protein-Protein Interaction Studies: Co-immunoprecipitation, yeast two-hybrid, or bimolecular fluorescence complementation can verify and characterize the reported interaction with Cis4 and identify other potential interaction partners .

  • Phenotypic Assays: Assessing phenotypes such as cell wall integrity, acid phosphatase secretion, and sensitivity to zinc depletion/excess in wild-type versus mutant strains provides insights into physiological function .

These methodologies should be employed in combination to develop a comprehensive understanding of SPBC16E9.14c function in cellular metal homeostasis.

How can researchers effectively use the recombinant SPBC16E9.14c protein in metal transport studies?

To effectively use recombinant SPBC16E9.14c in metal transport studies, researchers can employ several approaches:

  • Reconstitution in Liposomes: The purified recombinant protein can be incorporated into liposomes to create a controlled system for measuring direct metal transport. Zinc uptake can be assessed using either fluorescent zinc indicators (like FluoZin-3) or radioactive 65Zn isotopes.

  • In Vitro Binding Assays: Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) can determine the binding affinities of SPBC16E9.14c for various metal ions, including zinc, iron, and manganese, which are known substrates for related transporters .

  • Structural Studies: The recombinant protein can be used for structural analyses via X-ray crystallography or cryo-electron microscopy, providing insights into the molecular mechanisms of metal transport. The amino acid sequence provided in the product information can guide site-directed mutagenesis to identify critical residues for metal binding and transport.

  • Complementation Experiments: The recombinant protein can be used to restore function in knockout strains via transformation or expression systems, allowing for structure-function analyses through systematic mutations.

  • Antibody Generation: The recombinant protein can serve as an antigen for generating specific antibodies, which are valuable tools for detection, localization, and immunoprecipitation experiments.

When designing these experiments, it's important to consider the potential influence of the expression tag (which will be determined during the production process ) on protein function and to include appropriate controls to account for this variable.

How does SPBC16E9.14c interact with Cis4 to regulate zinc homeostasis in the Golgi apparatus?

The interaction between SPBC16E9.14c (Zrg17) and Cis4 represents a sophisticated mechanism for regulating zinc homeostasis in the Golgi apparatus. Research indicates that these two cation diffusion facilitator (CDF) proteins physically interact and share common zinc-suppressible phenotypes that are non-additive, suggesting they function in the same pathway .

This interaction likely forms a heterodimeric complex similar to what has been observed with their homologs in other organisms. The complex would be responsible for zinc uptake into the Golgi, particularly the cis-Golgi where Cis4 has been localized . This zinc transport is critical for proper Golgi function, as evidenced by the phenotypes observed in mutants, including weak cell wall and decreased acid phosphatase secretion .

To investigate this interaction further, researchers should employ:

  • Co-immunoprecipitation with truncation mutants to map the interaction domains

  • FRET or BRET analyses to visualize the interaction in living cells

  • Zinc transport assays in isolated Golgi vesicles from wild-type and mutant cells

  • Structural biology approaches to determine the configuration of the heterodimeric complex

Understanding this interaction has broader implications for cellular zinc homeostasis and membrane trafficking pathways, as proper Golgi function is essential for post-translational modifications and protein sorting.

What are the consequences of SPBC16E9.14c dysfunction on cellular metal homeostasis and downstream processes?

Dysfunction of SPBC16E9.14c (Zrg17) has multifaceted consequences for cellular metal homeostasis and downstream processes, based on phenotypic analyses of mutant strains. When considering the shared phenotypes with Cis4 mutants, SPBC16E9.14c dysfunction likely leads to:

  • Altered zinc distribution: Reduced zinc uptake into the Golgi would disrupt the activity of zinc-dependent enzymes in this compartment, affecting protein processing and glycosylation .

  • Impaired membrane trafficking: The observed phenotypes of weak cell wall and decreased acid phosphatase secretion in Cis4 mutants suggest that SPBC16E9.14c dysfunction similarly affects secretory pathway integrity .

  • Compromised cell wall integrity: The zinc-suppressible phenotypes shared between Cis4 and SPBC16E9.14c mutants indicate that proper cell wall formation depends on zinc homeostasis regulated by these transporters .

  • Global metal signaling disruption: Based on studies of other metal transporters, dysfunction in one transport system often triggers compensatory changes in other metal transporters, potentially creating imbalances in iron, manganese, or other metal ions .

To comprehensively analyze these consequences, researchers should employ:

  • Metalloproteomics approaches to profile changes in the metallome of subcellular compartments

  • Transcriptomics and proteomics to identify compensatory responses

  • Electron microscopy to assess ultrastructural changes in Golgi morphology

  • Functional assays for Golgi-specific processes such as protein glycosylation and sorting

These investigations would provide a systems-level understanding of how SPBC16E9.14c contributes to cellular homeostasis beyond its immediate role in zinc transport.

How might the function of SPBC16E9.14c compare with the SLC39A/ZIP family of metal transporters in higher eukaryotes?

While SPBC16E9.14c belongs to the cation diffusion facilitator (CDF) family rather than the SLC39A/ZIP family, comparing their functions provides valuable evolutionary and functional insights:

FeatureSPBC16E9.14c (CDF family)SLC39A/ZIP family
Direction of transportTypically efflux metals from cytoplasmImport metals into cytoplasm
Primary substratesZinc (based on yeast homology) Zinc, iron, manganese, potentially cadmium
RegulationLess understood, but not zinc-regulated based on ZIP comparisonsSome members upregulated by proinflammatory conditions (IL-6, nitric oxide); transcription factors AP-1, ATF4, ATF6α involved
Subcellular localizationGolgi membrane Plasma membrane and various organelles depending on specific transporter
Physiological impactCell wall integrity, secretory pathway function Varied: liver regeneration, resistance to ER stress, manganese excretion, intestinal barrier function

The comparative analysis suggests both convergent evolution in metal transport mechanisms and divergent specialization for specific cellular requirements. SPBC16E9.14c appears specialized for Golgi zinc homeostasis and membrane trafficking, while ZIP transporters like ZIP14 have evolved diverse roles in response to inflammatory signals and tissue-specific functions.

Research approaches to explore these evolutionary relationships should include:

  • Heterologous expression studies of SPBC16E9.14c in mammalian cells lacking specific ZIP transporters

  • Domain swapping experiments between SPBC16E9.14c and ZIP proteins to identify functional conservation

  • Metal selectivity profiling to compare substrate preferences under identical conditions

Such comparative studies would illuminate fundamental principles of metal transport that have been conserved or diversified through evolution.

What are the current limitations in studying SPBC16E9.14c and how might they be overcome?

Research on SPBC16E9.14c faces several significant limitations that researchers should acknowledge and address:

  • Limited functional characterization: As an "uncharacterized" transporter, basic properties like metal selectivity, transport kinetics, and regulation remain poorly defined . This can be addressed through systematic transport assays using radioactive or fluorescent metal indicators across different conditions.

  • Structural knowledge gaps: The lack of structural information hampers understanding of transport mechanisms. Researchers should prioritize structural biology approaches, including cryo-EM and X-ray crystallography, potentially using fungal homologs that may be more amenable to structural studies.

  • Physiological context uncertainty: The precise role of SPBC16E9.14c in S. pombe physiology requires clarification. This can be addressed through comprehensive phenotypic characterization of knockout strains under varying metal concentrations and stress conditions.

  • Technical challenges with metal transport assays: Measuring transport activity directly is complicated by overlapping substrate specificities with other transporters. Developing reconstituted systems with purified protein in proteoliposomes would enable direct measurement of transport activity.

  • Limited antibody availability: The development of specific antibodies against SPBC16E9.14c would facilitate studies of endogenous protein levels, localization, and interactions.

By systematically addressing these limitations, researchers can develop a more comprehensive understanding of SPBC16E9.14c function in cellular metal homeostasis.

How can researchers integrate studies of SPBC16E9.14c with broader investigations of cellular metal homeostasis?

Integrating SPBC16E9.14c research into broader metal homeostasis studies requires multidisciplinary approaches:

  • Systems biology framework: Researchers should position SPBC16E9.14c within the wider network of metal transporters and regulators in S. pombe through:

    • Genetic interaction screens to identify functional relationships

    • Transcriptomic analysis to map co-regulated genes under metal stress

    • Proteomic studies to identify the "metalloproteome" dependent on proper SPBC16E9.14c function

  • Comparative genomics approach: Analyzing SPBC16E9.14c homologs across fungal species can provide evolutionary insights into conserved metal homeostasis mechanisms. This should include comparison with the more extensively studied CDF transporters in S. cerevisiae and metal transporters in higher eukaryotes .

  • Integrative physiology: Researchers should examine how SPBC16E9.14c contributes to whole-cell responses to environmental metal fluctuations by:

    • Measuring metal content in subcellular compartments using fractionation and ICP-MS

    • Correlating Golgi zinc levels with secretory pathway function

    • Assessing interactions between zinc, iron, and manganese homeostasis pathways

  • Translational perspectives: While maintaining focus on basic science, researchers can explore how insights from SPBC16E9.14c might inform understanding of metal transport disorders in humans, particularly those involving related CDF proteins.

This integrated approach would position SPBC16E9.14c studies within the broader context of metal biology while uncovering its unique contributions to cellular function.

What novel experimental approaches could advance our understanding of SPBC16E9.14c transport mechanisms?

Several cutting-edge approaches could significantly advance our understanding of SPBC16E9.14c transport mechanisms:

  • Real-time metal sensing in live cells: Developing FRET-based zinc sensors targeted to the Golgi compartment would allow dynamic visualization of SPBC16E9.14c-mediated transport in intact cells. This approach could utilize genetically encoded sensors like eCALWY combined with SPBC16E9.14c variants.

  • Single-molecule transport studies: Reconstituting purified SPBC16E9.14c into nanodiscs or liposomes containing fluorescent metal sensors would enable measurement of transport kinetics at the single-molecule level, providing unprecedented insights into transport mechanisms.

  • Cryo-electron tomography: This technique could visualize the SPBC16E9.14c-Cis4 complex in its native membrane environment, preserving structural details that might be lost in other approaches.

  • AlphaFold2-guided mutagenesis: Using AI-predicted structures to guide site-directed mutagenesis of potential metal-binding and transport residues could accelerate functional characterization without requiring experimental structures.

  • Optogenetic control of transporter activity: Developing light-responsive SPBC16E9.14c variants would allow precise temporal control of transport activity, enabling studies of acute metal flux on Golgi function.

  • Proximity labeling proteomics: BioID or APEX2 fusions with SPBC16E9.14c would identify proximal proteins in the native cellular environment, revealing the broader functional network.

These innovative approaches would move beyond conventional techniques to address fundamental questions about transport mechanism, regulation, and physiological function of SPBC16E9.14c in a more direct and dynamic manner.

How can researchers utilize SPBC16E9.14c as a model for understanding zinc transport in higher eukaryotes?

SPBC16E9.14c offers several advantages as a model for understanding zinc transport mechanisms relevant to higher eukaryotes:

  • Evolutionary conservation: As a CDF family protein with homology to transporters found across eukaryotes, insights from SPBC16E9.14c likely apply to fundamental mechanisms of zinc transport . Researchers can leverage the genetic tractability of S. pombe to explore transport principles that would be challenging to study directly in mammalian systems.

  • Simplified system: S. pombe has fewer redundant zinc transporters compared to mammals, facilitating clearer interpretation of knockout phenotypes. This allows researchers to dissect specific transport pathways without the compensatory mechanisms that often obscure results in mammalian models.

  • Golgi function conservation: The role of SPBC16E9.14c in Golgi zinc homeostasis reflects a conserved requirement for zinc in this organelle across eukaryotes . Researchers can use this system to understand how zinc influences critical Golgi functions like protein modification and sorting.

  • Disease modeling: Human zinc transporter dysfunctions are implicated in various pathologies. SPBC16E9.14c studies can provide mechanistic insights relevant to these conditions, particularly those involving related CDF transporters.

Researchers should consider:

  • Complementation studies expressing human CDF transporters in SPBC16E9.14c mutants

  • Creating equivalent disease-associated mutations in SPBC16E9.14c to assess functional impacts

  • Developing high-throughput screening approaches in S. pombe to identify modulators of zinc transport

This model organism approach provides a powerful complement to studies in more complex systems while maintaining relevance to fundamental questions in zinc biology.

What are the implications of SPBC16E9.14c research for understanding metal-related pathologies?

Research on SPBC16E9.14c has significant implications for understanding metal-related pathologies in higher organisms, despite being a yeast protein:

  • Secretory pathway disorders: The involvement of SPBC16E9.14c in membrane trafficking and secretion suggests its dysfunction could model aspects of human diseases involving the secretory pathway . The weak cell wall and decreased acid phosphatase secretion phenotypes in mutants parallel secretory defects seen in various human disorders.

  • Zinc dyshomeostasis conditions: As zinc transporters, SPBC16E9.14c and its interaction partner Cis4 provide insights into fundamental mechanisms of zinc compartmentalization that are relevant to conditions like acrodermatitis enteropathica, transient neonatal zinc deficiency, and certain neurodegenerative disorders .

  • Cellular stress response: The relationship between metal transport and cellular stress responses seen in SPBC16E9.14c mutants parallels mechanisms in human diseases involving ER stress and inflammation. The ZIP family of transporters, which share functional similarities despite structural differences, are known to be involved in inflammation response and ER stress resistance .

  • Therapeutic target identification: Understanding basic mechanisms of metal transport through SPBC16E9.14c research could identify novel targets for therapies aimed at modulating metal levels in disease states. The zinc-suppressible phenotypes observed in mutants suggest potential approaches for intervention .

Researchers investigating these connections should focus on:

  • Comparative analyses of conserved functional domains between SPBC16E9.14c and human transporters

  • Identifying shared regulatory mechanisms responding to metal stress

  • Developing model systems to test pharmacological interventions

These translational insights demonstrate how fundamental research on yeast transporters contributes to our understanding of human health and disease.

How might SPBC16E9.14c be utilized in biotechnological applications?

SPBC16E9.14c offers several promising biotechnological applications based on its metal transport properties:

  • Biosensor development: The metal-binding properties of SPBC16E9.14c could be exploited to develop biosensors for zinc in biological samples or environmental monitoring. Fusion with reporter proteins like GFP variants could create zinc-responsive detection systems with high specificity.

  • Bioremediation technologies: Engineered microorganisms expressing modified SPBC16E9.14c variants could potentially be used for selective metal recovery from contaminated environments or industrial waste. The specificity of the transporter could be tuned through directed evolution approaches.

  • Protein production optimization: Understanding and manipulating zinc homeostasis in the secretory pathway through SPBC16E9.14c could enhance the production of recombinant proteins in yeast expression systems. This is particularly relevant for proteins requiring zinc for proper folding or function.

  • Metal-responsive gene expression systems: SPBC16E9.14c regulatory elements or modified versions of the protein could be developed into zinc-responsive gene expression systems for biotechnological applications requiring tight metal-dependent control.

  • Drug delivery systems: The understanding of SPBC16E9.14c transport mechanism could inform the design of metal-conjugated drug delivery systems that leverage cellular metal transport pathways for improved therapeutic delivery.

Implementation strategies should include:

  • Structure-function studies to identify domains suitable for engineering

  • Directed evolution approaches to optimize desired properties

  • Integration with existing biotechnological platforms

These applications highlight how fundamental research on metal transporters can translate into practical biotechnological innovations with potential environmental and medical benefits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.