Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C12D12.05c (SPBC12D12.05c)

Shipped with Ice Packs
In Stock

Description

Functional Context

While uncharacterized experimentally, bioinformatic analyses provide insights:

  • Role in Transport: Annotated under GO:0055085 (transmembrane transport) , suggesting involvement in mitochondrial metabolite exchange (e.g., nucleotides, cofactors) .

  • Phylogenetic Link: Shares homology with MCF proteins like NAD transporters and sulfate carriers .

  • Genomic Studies: A genome-wide deletion study in S. pombe identified SPBC12D12.05c as non-essential under standard conditions, but its absence may affect stress responses .

Research Applications

The recombinant protein is primarily used for:

  • ELISA Development: Commercial suppliers offer it for immunoassays (e.g., CSB-CF527217SXV) .

  • Structural Studies: Full-length production enables crystallization or cryo-EM analysis to resolve its transport mechanism .

  • Antibody Production: Immunogens for raising antibodies against mitochondrial carriers .

Comparative Analysis with Other MCF Proteins

ProteinFunctionExpression SystemUniProt ID
SPBC12D12.05cUncharacterized mitochondrial carrierE. coli/Mammalian cellsO94502
SPBC2A9.14Uncharacterized proteinMammalian cellsG2TRR6
Rtf1/Rtf2Replication fork barrier regulationN/AQ9P3W7

Limitations and Future Directions

  • Functional Gaps: No direct in vivo transport assays or substrate specificity data exist .

  • Potential Studies:

    • Metabolite Profiling: Identify transported substrates using reconstituted proteoliposomes.

    • Genetic Interaction Mapping: Link SPBC12D12.05c to metabolic pathways via synthetic lethality screens .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes section, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: Our standard shipping method includes blue ice packs. If you require dry ice shipping, please communicate this need in advance, as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference point for your convenience.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquoting is recommended for multiple uses to minimize freeze-thaw cycles. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its implementation during development.
Synonyms
SPBC12D12.05c; Uncharacterized mitochondrial carrier C12D12.05c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-426
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC12D12.05c
Target Protein Sequence
MPTELSDITIQSVLPCDYSLFKNNLRVSRLPESRFVFSPKEEINCQSLLQGPELKTALDN LNFIHKQKFEHQFRHGYWKLHPHPHHQHDSIIPASWIHDTPHMKLVFHRLQNLPDGDLLL ENDPKNNVGYFISGGIAGIVSRTCTAPLDRLKVMLISDTGSKPSPKYPFATLLHTTKVLW NRNGIRSFFVGNGINVLKVMPESSIKFGTYEAMKRVLGISSSSENHSPLYSYLAGGMAGS VAQMFIYPVDTLKFRIQCSDLSRGQHGKSIILSNAKELYKSVGIRGYYRGVLVGILGMFP YSATDLGTFEGLKRTWIGILASRDNVDPQDVKLPNGLVMAFGALSGSTGATIVFPLNVIR TRLQTQGTSAHPATYDGFIDCFYKTTKNEGFRGLYKGLSPNLLKVAPSVAISYLVYENCK KWLGLE
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of the SPBC12D12.05c mitochondrial carrier in S. pombe?

While SPBC12D12.05c remains uncharacterized, its classification as a mitochondrial carrier suggests it belongs to the larger mitochondrial carrier system (MCS) that transports small molecules between mitochondria and the cytoplasm. Based on homology with other carriers, it likely facilitates the exchange of metabolites, ions, or nucleotides across the inner mitochondrial membrane. The protein may participate in metabolic pathways critical for cellular respiration, energy production, or redox balance .

Mitochondrial carriers typically function through substrate exchange cycles that regulate mitochondrial and cytoplasmic redox balance. Some carriers operate through proton-linked symport (like MPC) or antiport mechanisms. Sequence analysis and structural predictions would be necessary to further refine functional hypotheses for this specific carrier .

How does SPBC12D12.05c compare structurally to characterized mitochondrial carriers?

Structural comparison would likely reveal similarities to other mitochondrial carriers, which typically contain:

  • Three tandem repeats of approximately 100 amino acids

  • Six transmembrane α-helices forming a characteristic "barrel-like" structure

  • A central substrate translocation pathway

  • Conserved signature motifs (PX[D/E]XX[K/R]) in each repeat

Comparative structural analysis with characterized carriers such as the ADP/ATP carrier (AAC) or uncoupling proteins (UCPs) would provide insights into substrate specificity. The carrier likely contains charged residues in the translocation pathway that determine substrate specificity and transport directionality .

What are the expression patterns of SPBC12D12.05c in S. pombe under different growth conditions?

Expression of SPBC12D12.05c likely varies depending on metabolic demands and growth conditions. While specific data for this carrier isn't provided in the search results, mitochondrial carriers typically show differential expression patterns based on:

  • Carbon source availability (fermentable versus non-fermentable)

  • Growth phase (log versus stationary)

  • Oxygen availability (aerobic versus anaerobic)

  • Stress conditions (oxidative, temperature, nutrient limitation)

RNA-seq or quantitative PCR analysis comparing expression levels across these conditions would help establish the regulatory profile of this carrier. Co-expression analysis with known mitochondrial genes could provide functional insights through guilt-by-association approaches .

What phenotypes are associated with SPBC12D12.05c deletion in S. pombe?

A systematic characterization of SPBC12D12.05c deletion mutants would assess:

  • Growth rates on different carbon sources

  • Mitochondrial membrane potential (using fluorescent dyes like TMRM)

  • Respiratory capacity (oxygen consumption rate)

  • Cell morphology and cytokinesis defects

  • Mitochondrial network morphology

Given what we know about other mitochondrial carriers, deletion phenotypes could range from subtle metabolic alterations to severe growth defects. Unlike Saccharomyces cerevisiae, S. pombe is petite-negative and cannot tolerate complete loss of mitochondrial function, making it more similar to higher organisms in this regard . If SPBC12D12.05c is essential, a conditional knockout system would be necessary for phenotypic analysis.

How might SPBC12D12.05c integrate with known metabolic pathways in S. pombe mitochondria?

SPBC12D12.05c likely participates in metabolite exchange that connects mitochondrial and cytosolic metabolic pathways. Potential integration points include:

  • The TCA cycle - transporting intermediates or their derivatives

  • Fatty acid metabolism - potentially transporting acyl-carnitines or related compounds

  • Amino acid metabolism - possibly transporting amino acids or derivatives

  • Nucleotide metabolism - transporting nucleotides or precursors

Metabolomic profiling of wildtype versus deletion mutants would identify accumulated or depleted metabolites, providing clues to transport specificity. Stable isotope labeling experiments would track metabolite flux alterations when SPBC12D12.05c function is perturbed .

Integration with the electron transport chain should be considered, as some carriers like uncoupling proteins (UCPs) can influence proton gradients and thereby affect oxidative phosphorylation efficiency. This could be assessed by measuring oxygen consumption rates and ATP production in deletion mutants .

What is the predicted substrate specificity of SPBC12D12.05c based on sequence homology?

Substrate prediction requires comparative sequence analysis with characterized carriers. Key determinants include:

  • Charged residues in the translocation pathway

  • Conservation of substrate-binding residues identified in homologous carriers

  • Presence of signature motifs associated with specific substrate classes

Homology modeling using structures of characterized carriers as templates could predict substrate-binding sites. The table below outlines common substrates transported by mitochondrial carriers:

Substrate ClassExamplesKey Structural Features
NucleotidesATP/ADP, GTP/GDPPositively charged residues in binding pocket
Organic acidsPyruvate, citrate, malateHydrogen-bonding residues
Amino acidsGlutamate, aspartatePolar side chain interactions
Inorganic ionsPhosphate, calciumCharged residues in channel

Biochemical validation of predicted substrates requires reconstitution in liposomes or transport assays in isolated mitochondria .

How does SPBC12D12.05c function in the context of S. pombe's unique mitochondrial properties compared to S. cerevisiae?

S. pombe possesses distinct mitochondrial characteristics compared to S. cerevisiae:

  • It is petite-negative, meaning it cannot survive with compromised mitochondrial function

  • Its mitochondrial genome is similar in size to humans and much smaller than S. cerevisiae

  • It has different respiratory requirements and fermentation capabilities

SPBC12D12.05c's function should be interpreted within this context. The carrier may play a more essential role in S. pombe compared to homologs in S. cerevisiae, reflecting the higher dependence on mitochondrial function. Comparative genomic analysis with S. cerevisiae and human mitochondrial carriers would identify evolutionary conservation patterns that might indicate functional importance .

Cross-complementation experiments where SPBC12D12.05c is expressed in S. cerevisiae mutants lacking specific carriers could help identify functional equivalence or divergence between the species.

What recombinant expression systems are optimal for characterizing SPBC12D12.05c?

Several expression systems can be considered for recombinant production of SPBC12D12.05c:

  • Homologous expression in S. pombe

    • Advantages: Native environment, correct post-translational modifications

    • Challenges: Lower protein yields compared to heterologous systems

  • Heterologous expression in E. coli

    • Advantages: High yield, easy genetic manipulation

    • Challenges: Membrane protein folding issues, lack of post-translational modifications

  • Expression in S. cerevisiae

    • Advantages: Eukaryotic processing, compatible with membrane proteins

    • Challenges: Potential misfolding due to species differences

  • Mammalian cell expression

    • Advantages: Complex eukaryotic processing capabilities

    • Challenges: Lower yields, more expensive

For functional characterization, expressing the protein with affinity tags (His, FLAG, etc.) would facilitate purification while minimizing interference with function. Codon optimization for the chosen expression system is recommended to improve expression levels .

What methods should be used to determine the subcellular localization of SPBC12D12.05c?

Confirming mitochondrial localization and inner membrane topology requires multiple approaches:

  • Fluorescent protein tagging:

    • C- or N-terminal GFP fusion proteins with mitochondrial markers

    • Live-cell confocal microscopy to confirm co-localization

  • Subcellular fractionation:

    • Differential centrifugation to isolate mitochondria

    • Western blotting using compartment-specific markers

    • Protease protection assays to determine membrane orientation

  • Immunogold electron microscopy:

    • Ultra-structural localization to specific mitochondrial compartments

    • Requires specific antibodies against SPBC12D12.05c

  • Mitochondrial import assays:

    • In vitro translation followed by import into isolated mitochondria

    • Analysis of processing and membrane integration

For determining topology, selective permeabilization of mitochondrial membranes combined with protease accessibility assays would map which protein domains face the matrix versus intermembrane space .

What transport assay systems would be appropriate for determining SPBC12D12.05c substrate specificity?

Several complementary approaches can determine transport function:

  • Liposome reconstitution assays:

    • Purified protein reconstituted into liposomes

    • Inside-out or right-side-out orientation

    • Radiolabeled substrate uptake measurements

    • Counterflow assays for exchange transport

  • Whole mitochondria transport assays:

    • Isolated mitochondria from wild-type and SPBC12D12.05c-deletion strains

    • Measurement of substrate uptake rates

    • Competition assays with potential substrates

  • Patch-clamp electrophysiology:

    • Direct measurement of transport activity

    • Ion selectivity and gating properties

    • Requires specialized equipment and expertise

  • Metabolomic profiling:

    • Comparative metabolomics of wild-type versus deletion strains

    • Stable isotope labeling to track metabolite flux

    • Identification of accumulated or depleted metabolites

A comprehensive substrate screen would test common mitochondrial metabolites including organic acids, amino acids, nucleotides, and cofactors at physiologically relevant concentrations and pH values .

How can genetic interactions help elucidate the function of SPBC12D12.05c?

Systematic genetic interaction analysis provides functional insights through:

  • Synthetic lethal/sick screens:

    • Identifying genes that become essential when SPBC12D12.05c is deleted

    • Reveals functional redundancy or parallel pathways

  • Suppressor screens:

    • Identifying mutations that rescue SPBC12D12.05c deletion phenotypes

    • Points to downstream pathways or compensatory mechanisms

  • Epistasis analysis:

    • Determining order of action in a pathway

    • Double mutant analysis with known mitochondrial function genes

The search results mention techniques for identifying synthetic-effect mutations, which could be applied to SPBC12D12.05c. For example, the approach used to study septin proteins in S. pombe identified synthetic interactions that revealed functional relationships .

Genetic interaction maps (similar to those created for S. cerevisiae) would place SPBC12D12.05c in the context of known cellular pathways and potentially reveal unexpected functional connections.

What challenges might arise in distinguishing the specific function of SPBC12D12.05c from other redundant mitochondrial carriers?

The mitochondrial carrier system exhibits multiple levels of functional redundancy that complicate analysis:

  • Direct redundancy:

    • Multiple carriers with overlapping substrate specificities

    • Example: The mammalian mitochondrial carrier system includes carriers with similar transport activities

  • Metabolic redundancy:

    • Different carriers transporting interconvertible metabolites

    • Example: Pyruvate transport bypass mechanisms through alternative metabolite shuttles

  • Systems-level adaptations:

    • Reorganization of metabolic fluxes to compensate for single carrier loss

    • Rerouting of metabolites through alternative pathways

To overcome these challenges:

  • Perform double/triple knockouts of related carriers

  • Use acute inactivation systems (e.g., degron tags) to minimize adaptation

  • Combine genetic approaches with direct transport assays

  • Develop specific inhibitors to acutely block transport activity

The search results mention that mitochondrial carriers exhibit functional redundancy at multiple levels, which would need to be considered when analyzing SPBC12D12.05c function .

How should contradictory experimental results regarding SPBC12D12.05c function be reconciled?

When encountering contradictory data, consider:

  • Technical variables:

    • Different expression systems or purification methods

    • Assay conditions (pH, temperature, ionic strength)

    • Protein tags affecting function

    • Contaminating proteins in preparations

  • Biological complexity:

    • Context-dependent functions in different cellular states

    • Regulatory modifications altering transport properties

    • Interactions with other proteins modulating function

    • Developmental or stress-specific roles

Reconciliation approaches include:

  • Systematic variation of experimental conditions to identify sources of discrepancy

  • Using multiple independent techniques to assess the same function

  • Employing both in vitro and in vivo approaches

  • Collaborating with labs using different methodologies for validation

Careful documentation of experimental conditions and transparent reporting of all results, including negative data, are essential practices for resolving contradictions.

How might high-throughput approaches advance understanding of SPBC12D12.05c function?

High-throughput methods offer powerful approaches for characterizing SPBC12D12.05c:

  • Metabolomics screens:

    • Comprehensive metabolite profiling of deletion mutants

    • Flux analysis using stable isotope labeling

    • Integration with transcriptomic data

  • Structural biology approaches:

    • Cryo-EM analysis of protein structure

    • Molecular dynamics simulations of transport mechanism

    • In silico substrate docking studies

  • Interactome analysis:

    • Proximity labeling (BioID, APEX) to identify interacting proteins

    • Co-immunoprecipitation coupled with mass spectrometry

    • Yeast two-hybrid or split-ubiquitin membrane protein interaction screens

  • CRISPR-based functional genomics:

    • Genome-wide screens for genetic interactions

    • CRISPRi for conditional repression studies

    • Base editing for structure-function studies

These approaches generate large datasets that, when integrated through computational biology methods, can reveal unexpected functional insights and place SPBC12D12.05c in the broader context of cellular metabolism .

What is the evolutionary significance of SPBC12D12.05c among mitochondrial carriers across species?

Evolutionary analysis provides context for functional conservation:

  • Phylogenetic profiling:

    • Identification of orthologs across fungal species

    • Presence/absence patterns correlating with metabolic capabilities

    • Conservation in higher eukaryotes including humans

  • Selection pressure analysis:

    • Identification of highly conserved residues under purifying selection

    • Detection of lineage-specific adaptations

  • Comparative genomics:

    • Synteny analysis for genomic context conservation

    • Gene duplication and specialization patterns

S. pombe serves as an excellent model for comparative studies with humans since its mitochondrial genome is similar in size to humans and much smaller than that of S. cerevisiae. If SPBC12D12.05c has human orthologs, understanding its function in S. pombe could have implications for human mitochondrial biology and disease .

How might characterization of SPBC12D12.05c contribute to understanding mitochondrial disease mechanisms?

Understanding SPBC12D12.05c function could provide insights into human mitochondrial diseases through:

  • Identification of human orthologs:

    • Functional characterization in S. pombe informing human studies

    • Potential disease associations with orthologous genes

  • Metabolic pathway insights:

    • Revealing novel regulatory mechanisms in mitochondrial metabolism

    • Identifying potential therapeutic targets for metabolic disorders

  • Stress response mechanisms:

    • Understanding how cells adapt to mitochondrial dysfunction

    • Identifying protective pathways that could be therapeutically enhanced

  • Model system development:

    • S. pombe as a platform for testing disease-associated variants

    • Drug screening for compounds that modify carrier function

The search results highlight that S. pombe is a petite-negative yeast that resembles higher organisms in its inability to tolerate loss of mitochondrial function, making it a valuable model for mitochondrial disease studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.