Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C1604.04 (SPBC1604.04)

What is SPBC1604.04 and why is it significant for study?

SPBC1604.04 is an uncharacterized mitochondrial carrier protein from the fission yeast Schizosaccharomyces pombe. It belongs to the Mitochondrial Carrier (MC) family, which typically mediates the transport of metabolites, nucleotides, and cofactors across the inner mitochondrial membrane. The significance of studying this protein lies in understanding novel transport mechanisms within mitochondria, particularly in a model organism that has contributed substantially to our understanding of cell cycle regulation and meiotic recombination .

The protein consists of 314 amino acids with a predicted molecular weight of approximately 35 kDa. Its amino acid sequence (MGLAKQKDSQEFAQPVWHYTLAGGISSVICRFMIAPFDVIKIRMQITQSSLRPVFKETVQKEGVRALWRGNVVAELLYLVYGAAEFVAFSKLKHLTENLAMNDHAVNFLCGTSAGIFATL TSYPLDTMRTKFASYAKTPHMPATKKIYAEAGIKGFFPGLKFSVIQIGPYAGCFFMFYR ASEAVLSPLGLALSSTLSGVIAGAGSKAIMFPVDTVVKTLQTFPSNYKSFKDCFLSIYRN SGIKGLYRGLSVSMKVAPGRYECLWLSCHFYYSIIYYLLNSMFYLLTFYSLRAITMLIYT QTLQGLRTLSSPEA) includes characteristic features of mitochondrial carriers .

How does S. pombe serve as a model organism for studying mitochondrial carriers?

S. pombe serves as an excellent model organism for studying mitochondrial carriers due to its several advantageous characteristics. With only three chromosomes, this fission yeast produces viable meiotic products (spores) even when recombination-deficient, facilitating genetic manipulation and analysis . The highly conserved nature of mitochondrial function across eukaryotes means that insights gained from S. pombe often translate to higher organisms.

Research methodologies for S. pombe are well-established, allowing for easy culturing, genetic modification, and analysis of phenotypes. Multiple independent meioses (>10^8) can be analyzed in a single experiment, providing statistical power for genetic studies . Additionally, the isogenic nature of commonly used strains facilitates the exchange of alleles and comparison of results between laboratories, making it an ideal system for collaborative research on proteins like SPBC1604.04.

What structural characteristics define mitochondrial carrier proteins like SPBC1604.04?

Mitochondrial carrier proteins, including SPBC1604.04, typically share a common structural organization characterized by:

• Three tandemly repeated homologous domains

• Each domain containing two transmembrane alpha-helices

• A total of six transmembrane segments forming a barrel-like structure

• A characteristic signature motif: P-X-[D/E]-X-X-[K/R]-X-[K/R]

• A three-fold pseudo-symmetry in the protein structure

These structural features create a channel through which specific substrates can be transported across the inner mitochondrial membrane. In the case of SPBC1604.04, bioinformatic analysis suggests its structure aligns with other members of the mitochondrial carrier family, though its specific substrate and transport mechanism remain to be experimentally determined .

What experimental approaches are most effective for characterizing the function of SPBC1604.04?

Characterizing the function of an uncharacterized mitochondrial carrier like SPBC1604.04 requires a multifaceted experimental approach combining genetic, biochemical, and computational methods:

Genetic Approaches:

• Gene knockout/knockdown studies to observe phenotypic effects

• Complementation assays with known mitochondrial carriers from other species

• Synthetic genetic array analysis to identify genetic interactions

Biochemical Approaches:

• Recombinant protein expression and purification for in vitro transport assays

• Reconstitution in liposomes with potential substrates to determine transport specificity

• Substrate competition assays to identify the natural substrate

Structural Biology Approaches:

• Cryo-EM or X-ray crystallography to determine three-dimensional structure

• Site-directed mutagenesis of conserved residues to identify functional domains

Computational Approaches:

• Homology modeling based on characterized mitochondrial carriers

• Molecular dynamics simulations to predict substrate binding and transport mechanism

When designing these experiments, it's critical to clearly define independent variables (e.g., protein expression levels, substrate concentrations) and dependent variables (e.g., growth rates, transport activity) while controlling for confounding factors that might affect mitochondrial function .

How might SPBC1604.04 interact with the cell cycle regulatory network in S. pombe?

The potential interaction between SPBC1604.04 and the cell cycle regulatory network in S. pombe represents an intriguing research question, especially considering the enrichment of cell cycle process genes in S. pombe transcriptional studies .

Mitochondrial carriers can influence the cell cycle through several mechanisms:

• Metabolic regulation: By controlling the flux of metabolites between mitochondria and cytosol, carriers can affect energy availability for cell cycle progression

• Signaling molecule transport: Some carriers transport molecules that act as second messengers in signaling pathways regulating the cell cycle

• Interaction with cell cycle proteins: Direct or indirect interactions with cyclins, cyclin-dependent kinases, or their regulators

To investigate these potential interactions, researchers could employ:

• Co-immunoprecipitation studies to identify physical interactions with cell cycle regulators like Cdc18, Cig2, or Yox1

• Cell synchronization experiments to analyze SPBC1604.04 expression levels throughout the cell cycle

• Transcriptomic analysis comparing wild-type and SPBC1604.04 mutant strains to identify affected cell cycle genes

The table below summarizes key cell cycle regulators in S. pombe that might interact with SPBC1604.04:

What bioinformatic approaches can reveal the evolutionary significance of SPBC1604.04?

Understanding the evolutionary significance of SPBC1604.04 requires sophisticated bioinformatic approaches that extend beyond simple sequence alignments. Researchers should consider:

• Phylogenetic analysis: Constructing comprehensive phylogenetic trees of mitochondrial carrier families across diverse species to determine the evolutionary history and conservation of SPBC1604.04

• Synteny analysis: Examining the conservation of genomic context around SPBC1604.04 to identify potential functional relationships with neighboring genes

• Positive selection analysis: Calculating dN/dS ratios across homologs to identify regions under purifying or positive selection, indicating functional constraints or adaptations

• Co-evolution network analysis: Identifying proteins that have co-evolved with SPBC1604.04, suggesting functional interactions or common regulatory mechanisms

• Ancestral sequence reconstruction: Predicting ancestral sequences to understand the evolutionary trajectory of the protein and key mutations that may have altered function

Implementation of these approaches requires careful consideration of methodological aspects, including sequence alignment algorithms, evolutionary models, and statistical frameworks for testing evolutionary hypotheses. Results should be interpreted in the context of known mitochondrial carrier functions and the specific metabolic requirements of different organisms throughout evolutionary history.

What are the optimal conditions for expressing and purifying recombinant SPBC1604.04?

The expression and purification of mitochondrial carrier proteins presents significant challenges due to their hydrophobic nature and tendency to aggregate. For SPBC1604.04, the following methodological approach is recommended:

Expression System Selection:

• E. coli systems: BL21(DE3) with pET vectors containing C-terminal His-tags are often effective for initial trials

• Yeast expression systems: Pichia pastoris or S. cerevisiae may provide more native-like folding

• Cell-free expression systems: Consider for toxic or difficult-to-express proteins

Optimization Parameters:

• Induction conditions: Lower temperatures (16-20°C) and reduced inducer concentrations often improve folding

• Media supplementation: Addition of glycerol (5-10%) can stabilize membrane proteins

• Fusion tags: Consider fusion with MBP or SUMO to enhance solubility

Purification Strategy:

• Membrane fraction isolation via differential centrifugation

• Solubilization using mild detergents (DDM, LDAO, or Fos-choline-12)

• Immobilized metal affinity chromatography (IMAC)

• Size exclusion chromatography to remove aggregates

• Optional ion exchange chromatography for further purification

Storage Conditions:

• Store in Tris-based buffer with 50% glycerol at -20°C for extended storage

• For functional studies, reconstitute in liposomes composed of E. coli polar lipids or a defined mixture of phosphatidylcholine, phosphatidylethanolamine, and cardiolipin

The purification should be monitored using SDS-PAGE, Western blotting, and activity assays to ensure protein integrity and functionality throughout the process.

How can researchers design effective genetic experiments to study SPBC1604.04 function in S. pombe?

Designing effective genetic experiments to study SPBC1604.04 function requires careful consideration of S. pombe's genetic manipulation techniques and experimental design principles:

Gene Disruption Strategies:

• Homologous recombination: Replace SPBC1604.04 with a selection marker (e.g., ura4+, kanMX6)

• CRISPR-Cas9 system: Generate precise deletions or mutations with minimal off-target effects

• Conditional systems: Use regulatable promoters (nmt1) for studying essential functions

Phenotypic Analysis:

• Growth assays: Compare growth rates on different carbon sources to identify metabolic defects

• Mitochondrial function tests: Measure oxygen consumption, membrane potential, and ROS production

• Cell cycle analysis: Use flow cytometry and microscopy to identify cell cycle defects

• Stress response: Test sensitivity to oxidative stress, temperature shifts, and DNA damaging agents

Complementation and Interaction Studies:

• Heterologous expression: Test functional conservation using human or other species' homologs

• Point mutations: Introduce mutations in conserved residues to identify critical functional domains

• Genetic interaction screens: Perform synthetic genetic array analysis to identify interacting genes

When designing these experiments, researchers must clearly define their variables following the key concepts of experimental design :

• Independent variable: The genetic manipulation (e.g., gene deletion, point mutation)

• Dependent variable: The phenotypic outcome (e.g., growth rate, mitochondrial function)

• Control variables: Strain background, growth conditions, etc.

• Confounding variables: Consider metabolic state, cell density, and other factors that might influence results

What proteomics approaches can identify interaction partners of SPBC1604.04?

Identifying protein-protein interactions of SPBC1604.04 requires specialized proteomics approaches adapted for membrane proteins:

Affinity-Based Methods:

• Affinity purification-mass spectrometry (AP-MS): Use epitope-tagged SPBC1604.04 to pull down interaction partners

  • Consider both N- and C-terminal tags to avoid disrupting functional domains

  • Use crosslinking methods to capture transient interactions

  • Implement SILAC or TMT labeling for quantitative comparison

• Proximity-dependent biotin identification (BioID): Fuse SPBC1604.04 with a biotin ligase to biotinylate nearby proteins

  • Particularly useful for identifying weak or transient interactions

  • Consider using TurboID for faster labeling kinetics in yeast systems

Structural and Biophysical Methods:

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map interaction interfaces with high resolution

• Crosslinking mass spectrometry (XL-MS): Identify spatial relationships between interacting proteins

• Surface plasmon resonance (SPR): Measure binding kinetics of purified interaction partners

Data Analysis and Validation:

• Filtering strategies: Compare against control pulldowns to eliminate common contaminants

• Network analysis: Place identified interactions in the context of known mitochondrial and metabolic networks

• Functional validation: Confirm key interactions using targeted approaches like co-immunoprecipitation or FRET

When implementing these approaches, researchers should pay special attention to membrane solubilization conditions, as harsh detergents may disrupt physiologically relevant interactions. Mild detergents like digitonin or nonionic detergents at low concentrations often preserve protein-protein interactions better than stronger ionic detergents.

How can researchers integrate transcriptomic and proteomic data to understand SPBC1604.04 function?

Integrating transcriptomic and proteomic data provides a comprehensive view of SPBC1604.04 function within cellular networks. This multi-omics approach should follow these methodological steps:

• Data Generation and Processing:

  • Perform RNA-seq on wild-type and SPBC1604.04 mutant strains under various conditions

  • Conduct quantitative proteomics using techniques like TMT or SILAC labeling

  • Process raw data using standardized pipelines to ensure comparability

• Integration Strategies:

  • Correlation analysis: Calculate Pearson or Spearman correlations between transcript and protein levels

  • Pathway enrichment: Identify pathways affected at both transcriptional and proteomic levels

  • Network reconstruction: Build gene regulatory networks incorporating both data types

• Advanced Computational Methods:

  • Implement machine learning approaches to identify patterns across datasets

  • Apply Bayesian network modeling to infer causal relationships

  • Use dimensionality reduction techniques like PCA or t-SNE to visualize integrated data

• Biological Interpretation:

  • Focus on genes/proteins with concordant changes across datasets

  • Identify post-transcriptional regulation by looking for discordant changes

  • Place findings in the context of known mitochondrial function and cell cycle regulation

This integrated analysis could reveal connections between SPBC1604.04 and cell cycle regulation, as suggested by the enrichment of cell cycle process genes in transcriptional studies . For example, the potential relationship with genes like cdc18, cig2, and yox1, which show significant fold changes in related studies, could be explored through this multi-omics approach.

What are the best practices for analyzing substrate specificity of SPBC1604.04?

Determining substrate specificity of mitochondrial carriers requires rigorous experimental design and careful data analysis:

Experimental Approaches:

• Liposome reconstitution assays:

  • Purify SPBC1604.04 and reconstitute in liposomes

  • Load liposomes with potential substrates

  • Measure substrate exchange/transport rates using radioisotope or fluorescence-based methods

• Cellular transport assays:

  • Express SPBC1604.04 in transport-deficient yeast strains

  • Measure substrate uptake or metabolic complementation

• Binding assays:

  • Isothermal titration calorimetry (ITC) to measure binding affinities

  • Microscale thermophoresis (MST) for detecting interactions with small molecules

Data Analysis Methodology:

• Kinetic parameter determination:

  • Calculate Km and Vmax values for different substrates

  • Compare transport efficiency (Vmax/Km) across substrate candidates

  • Analyze inhibition patterns to understand transport mechanism

• Specificity analysis:

  • Test structurally related compounds to build structure-activity relationships

  • Construct specificity profiles based on charge, size, and hydrophobicity

  • Compare with known mitochondrial carriers like ADP/ATP carriers

• Statistical considerations:

  • Use appropriate statistical tests (ANOVA, t-tests) with multiple testing correction

  • Include positive controls (known transporters) and negative controls

  • Report effect sizes along with p-values

By comparing substrate transport kinetics with those of characterized mitochondrial carriers (e.g., ADP/ATP carriers with Km values of 10-100 μM for their substrates ), researchers can gain insights into the physiological role of SPBC1604.04 and its potential involvement in energy metabolism or other mitochondrial functions.

How can computational modeling predict the impact of SPBC1604.04 mutations?

Computational modeling offers powerful approaches to predict how mutations affect SPBC1604.04 structure and function:

Structural Modeling Approaches:

• Homology modeling:

  • Use structures of characterized mitochondrial carriers as templates

  • Validate models using Ramachandran plots, DOPE scores, and other quality metrics

  • Refine models through molecular dynamics simulations

• Molecular dynamics simulations:

  • Simulate protein behavior in a membrane environment

  • Analyze conformational changes during substrate binding and transport

  • Estimate energy barriers for transport processes

Mutation Effect Prediction:

• Stability calculations:

  • Calculate ΔΔG values using tools like FoldX or Rosetta

  • Identify mutations likely to disrupt protein folding

• Functional impact prediction:

  • Use conservation analysis to identify functionally critical residues

  • Apply machine learning algorithms trained on known mutation effects

  • Simulate substrate binding with mutant structures

• Systems-level prediction:

  • Model effects on metabolic pathways using flux balance analysis

  • Predict phenotypic outcomes based on metabolic network perturbations

Validation Strategy:

• Prioritize mutations for experimental validation based on computational predictions

• Test a subset of mutations experimentally to refine predictive models

• Use iterative cycles of prediction and validation to improve model accuracy

The amino acid sequence provided (MGLAKQKDSQEFAQPVWHYTLAGGISSVICRFMIAPFDVIKIRMQITQSSLRPVFKETVQKEGVRALWRGNVVAELLYLVYGAAEFVAFSKLKHLTENLAMNDHAVNFLCGTSAGIFATL TSYPLDTMRTKFASYAKTPHMPATKKIYAEAGIKGFFPGLKFSVIQIGPYAGCFFMFYR ASEAVLSPLGLALSSTLSGVIAGAGSKAIMFPVDTVVKTLQTFPSNYKSFKDCFLSIYRN SGIKGLYRGLSVSMKVAPGRYECLWLSCHFYYSIIYYLLNSMFYLLTFYSLRAITMLIYT QTLQGLRTLSSPEA) can be analyzed to identify conserved motifs and predict critical functional residues for targeted mutagenesis.