Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C19G12.05 (SPAC19G12.05)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format during order placement and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. For dry ice shipping, please communicate your request in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know and we will prioritize developing it for you.
Synonyms
SPAC19G12.05; Uncharacterized mitochondrial carrier C19G12.05
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC19G12.05
Target Protein Sequence
MSTVAKTNPKSSNKPGPVKSIIAGGVAGAIEISITYPAEFAKTRLQLYRNVEGTKAKLPP FGLEWYRGCSTVIVGNSLKAAVRFFAFDSIKKSLSDEHGHLTGPRTVLAGLGAGVAESVL VLTPFESIKTAIIDDRKRPNPRLKGFLQASRIIVHENGIRGLYRGLAATVARQAANSGVR FTAYNSIKQSLQSRLPPDEKLSTVTTFLVGSVAGIITVYCTQPIDTVKSRMQSLSASKEY KNSIHCAYKILTQDGLLRFWSGATPRLARLILSGGIVFTVYEKVMEILKPF
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of SPAC19G12.05 based on its sequence homology to known mitochondrial carriers?

SPAC19G12.05 is predicted to function as a mitochondrial carrier protein based on sequence homology with the SLC25 carrier family. Mitochondrial carriers typically transport a variety of compounds across the inner membrane of mitochondria, providing essential building blocks for the cell and linking metabolic pathways between the mitochondrial matrix and cytosol . While the specific substrate for SPAC19G12.05 remains uncharacterized, comparative sequence analysis suggests it may be involved in metabolite transport similar to other members of this family. Unlike characterized carriers such as the ADP/ATP carrier or aspartate/glutamate carrier, the specific substrates and physiological role of SPAC19G12.05 remain to be determined through functional studies.

Methodology for prediction: Researchers should employ multiple sequence alignment tools comparing SPAC19G12.05 with characterized SLC25 family members, followed by phylogenetic analysis and structural prediction. These computational approaches can provide initial insights into potential substrates and transport mechanisms.

How is SPAC19G12.05 expression regulated in S. pombe under different growth conditions?

The expression of SPAC19G12.05, like many mitochondrial proteins in S. pombe, is likely regulated in response to metabolic demands and environmental conditions. Research on related mitochondrial components suggests that SPAC19G12.05 expression may be influenced by glucose availability and mitochondrial function. For instance, in S. pombe, transcription factors like Rst2 are activated upon glucose deprivation and can regulate gene expression . Additionally, inhibition of mitochondrial complex III/IV has been shown to generate reactive oxygen species (ROS) and nitric oxide (NO), which activate transcription factors .

Experimental approach: To determine expression regulation, researchers should perform RT-qPCR and transcriptome analyses under various conditions including different carbon sources, oxygen availability, and stress conditions. Additionally, chromatin immunoprecipitation (ChIP) experiments can identify transcription factors that bind to the SPAC19G12.05 promoter region.

What is the predicted structure of SPAC19G12.05 compared to characterized mitochondrial carriers?

Based on knowledge of other mitochondrial carriers, SPAC19G12.05 likely contains six transmembrane helices arranged in three similar modules of approximately 100 amino acids each, a characteristic feature of the mitochondrial carrier family. Most mitochondrial carriers function as monomers , with each monomer forming a transport channel. The protein likely contains the conserved PX[DE]XX[KR] motif on the matrix side of each odd-numbered transmembrane helix, which is important for the transport mechanism in this family.

Structural analysis approach: To confirm these predictions, researchers should use computational structure prediction tools followed by experimental approaches such as circular dichroism, limited proteolysis, and potentially X-ray crystallography or cryo-electron microscopy for definitive structural characterization.

What experimental approaches are most effective for determining the specific substrate of SPAC19G12.05?

Determining the substrate specificity of uncharacterized mitochondrial carriers requires a multi-faceted approach:

  • Reconstitution in liposomes: Purified recombinant SPAC19G12.05 should be reconstituted into liposomes for transport assays with various potential substrates. This method has been successfully used to characterize other mitochondrial carriers .

  • Deletion and complementation studies: Creating SPAC19G12.05 deletion strains and measuring metabolic changes can provide clues about substrate specificity. Complementation with known mitochondrial carriers from other species may restore function if they transport similar substrates.

  • Metabolomic profiling: Comprehensive metabolomic analysis comparing wild-type and SPAC19G12.05 deletion strains can identify accumulated or depleted metabolites, suggesting potential substrates.

  • Substrate competition assays: Using potential substrate analogs to compete with radiolabeled substrates in transport assays can help narrow down the specific molecule transported.

Data table of potential substrates to test based on other mitochondrial carriers:

Substrate CategorySpecific CompoundsDetection MethodControl Carrier
NucleotidesATP, ADP, AMP, GTP, GDPRadiolabeled substratesADP/ATP carrier
Amino acidsGlutamate, aspartate, ornithineHPLC, radiolabeled amino acidsGlutamate carrier
Carboxylic acidsMalate, succinate, citrateEnzymatic assaysDicarboxylate carrier
CofactorsNAD+, FAD, coenzyme ASpectrophotometric assaysNAD+ carrier
Inorganic ionsPhosphate, sulfateRadiolabeled ionsPhosphate carrier

How does the function of SPAC19G12.05 interact with mitochondrial complex III/IV and respiratory metabolism?

The relationship between SPAC19G12.05 and mitochondrial respiratory complexes is likely significant, as mitochondrial carriers often facilitate metabolite exchange necessary for respiratory function. Research on S. pombe has shown that inhibition of mitochondrial complex III/IV causes cells to produce reactive oxygen species and nitric oxide, activating stress-responsive transcription factors like Rst2 . SPAC19G12.05 may play a role in this signaling pathway or in compensating for metabolic changes during respiratory stress.

Experimental design:

  • Create double mutants of SPAC19G12.05 and components of complex III/IV to identify genetic interactions

  • Measure respiratory capacity, ROS production, and NO generation in SPAC19G12.05 deletion strains

  • Analyze the effect of complex III/IV inhibitors on SPAC19G12.05 expression and localization

  • Perform metabolic flux analysis to determine how SPAC19G12.05 deletion affects respiratory metabolism

What is the role of SPAC19G12.05 in nutrient sensing and starvation response?

S. pombe strains lacking components like tsc1+ and tsc2+ (tuberous sclerosis complex proteins) exhibit defects in nutrient uptake and sensing/responding to starvation . As a mitochondrial carrier, SPAC19G12.05 may play a role in mediating metabolite transport during nutrient limitation. The connection to the Rhb1 pathway (fission yeast homolog of human RHEB) could be significant, as Rhb1 is involved in amino acid sensing and TOR signaling .

Research approach:

  • Investigate SPAC19G12.05 expression during nutrient limitation and starvation

  • Analyze phenotypes of SPAC19G12.05 deletion strains under various nutrient conditions

  • Determine if SPAC19G12.05 deletion affects amino acid permease localization, similar to tsc1/tsc2 deletions

  • Examine potential genetic interactions between SPAC19G12.05 and components of nutrient sensing pathways

What are the optimal conditions for expressing recombinant SPAC19G12.05 for functional studies?

Expression of recombinant mitochondrial carriers presents several challenges due to their hydrophobic nature and complex folding requirements. The following approach is recommended:

  • Expression system selection:

    • For initial characterization, use bacterial systems (E. coli) with specialized strains designed for membrane proteins

    • For more native-like modifications, consider using S. cerevisiae or insect cell systems

    • Include purification tags (His, FLAG) that can be cleaved post-purification

  • Optimization parameters:

    • Induce expression at lower temperatures (16-20°C) to improve folding

    • Use mild detergents (DDM, LDAO) for extraction and purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Include stabilizing ligands during purification if potential substrates are known

  • Quality control metrics:

    • Assess protein homogeneity by size-exclusion chromatography

    • Verify folding by circular dichroism

    • Confirm functionality with transport assays in proteoliposomes

Based on approaches used for other mitochondrial carriers, the following protocol modifications may be necessary:

  • Addition of cardiolipin during reconstitution, as it's crucial for carrier function

  • Screening multiple detergents to identify optimal extraction conditions

  • Using ligand-affinity chromatography if substrate candidates are identified

How can researchers accurately measure the transport activity of SPAC19G12.05 in vitro?

Accurately measuring transport activity requires reconstitution of purified carrier into liposomes and design of appropriate assays. The following methodological considerations are crucial:

  • Proteoliposome preparation:

    • Use a lipid composition mimicking the inner mitochondrial membrane (phosphatidylcholine, phosphatidylethanolamine, cardiolipin)

    • Control protein-to-lipid ratio (typically 1:100 to 1:20)

    • Ensure uniform vesicle size through extrusion

  • Transport measurement approaches:

    • Direct measurement using radiolabeled substrates

    • Fluorescent substrate analogs with spectrofluorometric detection

    • Counterflow assays where internal and external substrates compete

    • Indirect coupling to enzymatic reactions for continuous monitoring

  • Control experiments:

    • Include liposomes without protein as negative controls

    • Use liposomes with well-characterized carriers as positive controls

    • Perform transport inhibition studies with known mitochondrial carrier inhibitors

    • Include competition assays with excess unlabeled substrate

The experimental setup should account for temperature dependence, pH sensitivity, and potential requirement for membrane potential, as these factors significantly affect carrier activity.

What genetic approaches can help establish the physiological role of SPAC19G12.05 in S. pombe?

Several genetic approaches can reveal the physiological function of SPAC19G12.05:

  • Gene deletion and phenotypic analysis:

    • Create precise gene deletion using homologous recombination

    • Analyze growth characteristics under various conditions (carbon sources, temperatures, stressors)

    • Examine mitochondrial morphology, membrane potential, and function

    • Measure cellular respiration rates and ATP production

  • Complementation studies:

    • Express SPAC19G12.05 under control of its native promoter in deletion strains

    • Test cross-species complementation with homologs from other organisms

    • Create chimeric proteins with domains from characterized carriers to identify functional regions

  • High-resolution phenotyping:

    • Perform genome-wide synthetic genetic array (SGA) analysis to identify genetic interactions

    • Conduct metabolomic profiling to detect changes in metabolite pools

    • Use fitness profiling across growth conditions to identify condition-specific requirements

  • Localization and dynamics:

    • Create GFP/RFP fusions to confirm mitochondrial localization

    • Use temperature-sensitive alleles to study essential functions

    • Apply microscopy to study protein dynamics during cellular stress

How should researchers interpret contradictory functional data for SPAC19G12.05?

When faced with contradictory functional data for SPAC19G12.05, researchers should consider the following analytical framework:

  • Methodological differences:

    • Compare experimental conditions (pH, temperature, ionic strength)

    • Examine protein preparation methods (detergents, purification tags)

    • Assess reconstitution protocols (lipid composition, protein:lipid ratio)

    • Review assay sensitivity and specificity

  • Genetic background effects:

    • Sequence the entire SPAC19G12.05 locus to verify strain integrity

    • Examine expression of other mitochondrial carriers that might compensate

    • Consider epistatic interactions with strain-specific genetic variants

    • Verify phenotypes in multiple independently derived strains

  • Physiological context:

    • Compare results from different growth phases and metabolic states

    • Consider the impact of mitochondrial membrane potential on activity

    • Examine potential post-translational modifications affecting function

    • Analyze substrate availability in different experimental systems

  • Systematic validation approach:

    • Develop multiple independent assays for the same function

    • Perform cross-laboratory validation studies

    • Use both in vivo and in vitro approaches to confirm findings

    • Employ complementary biochemical and genetic methods

Researchers should also consider the possibility that SPAC19G12.05 may have multiple functions or substrates depending on cellular conditions, similar to other mitochondrial carriers .

What are the critical control experiments needed when studying SPAC19G12.05 function?

When studying SPAC19G12.05 function, the following control experiments are essential:

  • Expression and localization controls:

    • Verify protein expression levels by Western blot

    • Confirm mitochondrial localization using fractionation and microscopy

    • Use tagged versions to ensure protein integrity

    • Compare expression in native context versus heterologous systems

  • Functional assay controls:

    • Include well-characterized mitochondrial carriers as positive controls

    • Use empty vectors or inactive mutants as negative controls

    • Perform substrate specificity controls with structurally related compounds

    • Include inhibitor controls to verify transport mechanism

  • Phenotypic analysis controls:

    • Compare with knockout strains of known mitochondrial carriers

    • Include wild-type strains grown under identical conditions

    • Use complemented strains to confirm phenotype rescue

    • Analyze multiple independent clones to rule out secondary mutations

  • Specificity controls:

    • Test other members of the carrier family to establish specificity

    • Use site-directed mutagenesis of key residues to confirm function

    • Perform dose-response studies for substrates and inhibitors

    • Include chemical analogs to verify binding site requirements

How can researchers distinguish between direct and indirect effects when studying SPAC19G12.05 deletion phenotypes?

Distinguishing direct from indirect effects in SPAC19G12.05 deletion studies requires systematic approaches:

  • Temporal analysis:

    • Use inducible or repressible expression systems to observe immediate versus long-term effects

    • Perform time-course analyses after gene deletion or inhibition

    • Monitor rapid changes in metabolite levels following acute inhibition

  • Biochemical verification:

    • Demonstrate direct transport of putative substrates in reconstituted systems

    • Perform binding studies with purified protein

    • Use chemical crosslinking to identify direct interaction partners

    • Engineer substrate specificity mutations to confirm direct effects

  • Genetic approaches:

    • Create point mutations in key functional residues rather than complete deletions

    • Use suppressor screens to identify genes that can bypass the requirement for SPAC19G12.05

    • Perform epistasis analysis with genes in related pathways

    • Use double mutant analysis to test pathway relationships

  • Systems biology approaches:

    • Compare transcriptome and proteome changes to known response signatures

    • Use metabolic flux analysis to trace metabolite flow

    • Apply network analysis to distinguish primary from secondary effects

    • Develop computational models to predict direct consequences of transporter inhibition

How can studying SPAC19G12.05 contribute to understanding human mitochondrial carrier diseases?

Studying SPAC19G12.05 in S. pombe can provide valuable insights into human mitochondrial carrier diseases through several research approaches:

  • Comparative genomics and functional conservation:

    • Identify human homologs of SPAC19G12.05 through sequence analysis

    • Determine if human homologs can complement SPAC19G12.05 deletion in S. pombe

    • Compare substrate specificity and regulation between yeast and human carriers

    • Use yeast as a platform to study human mutations in a simplified cellular context

  • Disease modeling:

    • Introduce mutations corresponding to human disease variants in SPAC19G12.05

    • Study effects on mitochondrial function, morphology, and cellular metabolism

    • Screen for compounds that can rescue mutant phenotypes

    • Use high-throughput approaches to identify genetic modifiers of disease phenotypes

Mitochondrial carrier defects in humans cause a range of diseases, from mild to severe manifestations . The SLC25 family has been implicated in various disorders, with mutations causing specific clinical phenotypes. By establishing the function of SPAC19G12.05, researchers may identify previously unknown roles for mitochondrial carriers in human disease.

What novel techniques are being developed to study mitochondrial carrier function that could be applied to SPAC19G12.05?

Emerging techniques that could accelerate SPAC19G12.05 characterization include:

  • Advanced structural biology methods:

    • Cryo-electron microscopy for membrane protein structure determination

    • Hydrogen-deuterium exchange mass spectrometry to study conformational changes

    • Single-molecule FRET to observe transport dynamics in real-time

    • Nanodiscs for studying carriers in a more native-like membrane environment

  • Cutting-edge functional genomics:

    • CRISPR-based screening to identify genetic interactions

    • Single-cell transcriptomics to detect heterogeneous responses

    • Proximity labeling techniques (BioID, APEX) to identify interaction partners

    • Mitochondrial-targeted biosensors to monitor local substrate concentrations

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Constraint-based metabolic modeling to predict transporter functions

    • Machine learning for predicting substrate specificity from sequence

    • Network analysis to position SPAC19G12.05 within metabolic pathways

These novel approaches can complement traditional biochemical and genetic methods to provide a more comprehensive understanding of SPAC19G12.05 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.