Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C227.03c (SPAC227.03c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us beforehand, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPAC227.03c; Uncharacterized mitochondrial carrier C227.03c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC227.03c
Target Protein Sequence
MVDDSLKDAIAGGAAGLASSLVVAPLDVVKTRKQAQKAFYSTGGGKNTMVLGGTLSSMRT IFHNEGIAGLYRGVGPMMLGYLPSWSIYFVVYEKCKVLFGVNKKYTSLHEIDSSKVGIKA SLDSSDKQFYRYWGGQIFSAVIAGAASVTLTNPIWVVKTRLVTQSHPRASSFVDKIAAAT TVQFRNLQTDAPSVKWRMPRFWLKRRTNVKSSPSQHPVNPPTGPACSPAYNNTFDAFRKI YKYEGLAAFYRGLFPSLFGTLHVGIQFPLYEYFKSFLDDFFGKKSNFHIVLAATLSKIAA STVTYPHEVLRTRLQSLDAPTHNSATLLIRDIWRSEGWRKYYSGMATNFIRTIPASSVTF LSFEIVRKWLN
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SPAC227.03c and how does it relate to other mitochondrial carriers in S. pombe?

SPAC227.03c is an uncharacterized mitochondrial carrier protein in Schizosaccharomyces pombe. While specific information about this particular carrier is limited, it belongs to a broader class of proteins involved in mitochondrial transport processes. S. pombe mitochondrial proteins are of particular interest because the organism's mitochondrial structure and function closely resemble those of human cells, making it an excellent model for studying mitochondrial biology and related diseases .

Methodologically, researchers should approach SPAC227.03c characterization by first conducting sequence homology analyses against known mitochondrial carriers in other species. This can be followed by localization studies using GFP-tagging and subcellular fractionation to confirm its mitochondrial localization. Comparative genomics approaches can further help identify conserved domains and potential functions based on structural similarities to characterized carriers .

Why is S. pombe considered an effective model for studying mitochondrial carriers like SPAC227.03c?

S. pombe has emerged as a powerful model for mitochondrial research due to several key similarities with human cells. According to recent studies, fission yeast resembles human cells in critical aspects, including:

  • Mitochondrial inheritance patterns

  • Mitochondrial transport mechanisms

  • Sugar metabolism

  • Mitogenome structure

  • Dependence on mitochondrial genome for viability (petite-negative phenotype)

Furthermore, the machinery for mitochondrial gene expression is structurally and functionally conserved between fission yeast and humans. This conservation makes S. pombe particularly valuable for studying mitochondrial carriers like SPAC227.03c, as findings may translate to human biology .

From a methodological standpoint, researchers benefit from the extensive experimental techniques and database resources available for S. pombe, which facilitate comprehensive analysis of mitochondrial proteins. The organism's genetic tractability enables straightforward creation of deletion mutants and protein tagging, while its relatively simple genome simplifies data interpretation .

What expression patterns does SPAC227.03c show during the cell cycle?

While specific expression data for SPAC227.03c is not directly available in the search results, researchers can employ several methodological approaches to characterize its expression pattern:

  • Temporal RNA-seq analysis: Using platforms like MultiRNAflow, researchers can track expression changes across different cell cycle phases. This R package allows for integrated analysis of temporal transcriptomic data, enabling identification of genes with similar expression patterns .

  • Clustering analysis: Implementing temporal clustering methods such as those provided by the MFUZZanalysis() function can group genes with similar expression profiles, potentially revealing functional relationships between SPAC227.03c and better-characterized genes .

  • Visualization tools: Functions like DATAplotExpressionGenes() can generate detailed expression profiles to visualize how SPAC227.03c expression changes throughout the cell cycle .

For mitochondrial carriers in S. pombe generally, expression patterns often correlate with metabolic demands during cell cycle progression. Systematic analysis tools like those mentioned above can help researchers determine whether SPAC227.03c expression is constitutive or regulated in response to specific cellular conditions.

What are the most effective experimental approaches for characterizing SPAC227.03c function?

Characterizing uncharacterized mitochondrial carriers like SPAC227.03c requires a multi-faceted approach:

  • Gene deletion studies: Create SPAC227.03c deletion mutants and assess phenotypic changes. Systematic screens have successfully identified genes affecting cell cycle progression and cellular functions in S. pombe .

  • Overexpression analysis: Express SPAC227.03c under control of an inducible promoter to observe gain-of-function phenotypes. Previous studies have shown that overexpression of certain cell cycle regulators can cause cell elongation, indicating cell cycle defects .

  • Protein localization: Use fluorescent protein tagging to confirm mitochondrial localization and any dynamic changes in subcellular distribution.

  • Metabolic profiling: Analyze metabolite changes in deletion or overexpression strains to identify potential transported substances.

  • Protein interaction studies: Implement co-immunoprecipitation or proximity labeling to identify interaction partners.

Experimental ApproachExpected OutcomeTechnical Considerations
Gene deletionPhenotypic effects on growth, metabolism, mitochondrial functionMay be lethal if essential; create conditional mutants
OverexpressionGain-of-function effects, possible dominant negative phenotypesUse regulatable promoters (nmt1) with varying strengths
Protein localizationSubcellular distribution, dynamic changesEnsure tag doesn't interfere with function or localization
Metabolic profilingChanges in metabolite profiles indicating substrateRequires sensitive analytical techniques (MS, NMR)
Protein interactionIdentification of physical interactorsMay require crosslinking for transient interactions

How can differential expression analysis help identify conditions affecting SPAC227.03c expression?

Differential expression analysis provides critical insights into the conditions that regulate SPAC227.03c expression. Methodologically, researchers should:

  • Design comprehensive RNA-seq experiments: Include multiple time points and various stress conditions to capture dynamic expression changes.

  • Apply appropriate statistical frameworks: Utilize packages like DESeq2, which forms the statistical backbone of MultiRNAflow, to identify statistically significant expression changes .

  • Implement temporal analysis: Use the DEanalysisGlobal() function to perform time-series differential expression analysis, which can reveal when SPAC227.03c is up- or down-regulated during specific cellular processes .

  • Visualize expression patterns: Generate volcano plots, MA plots, and heatmaps using functions like DEplotVolcanoMA() and DEplotHeatmaps() to visualize expression changes in context with other genes .

  • Conduct clustering analysis: Group SPAC227.03c with genes showing similar expression patterns using unsupervised clustering techniques to identify potential functional relationships and regulatory networks .

This methodological framework allows researchers to identify specific conditions (oxidative stress, nutrient limitation, temperature shifts) that affect SPAC227.03c expression, providing clues to its function in cellular metabolism and mitochondrial processes.

What can gene deletion studies reveal about SPAC227.03c's role in cellular function?

Gene deletion studies represent a powerful approach to understanding SPAC227.03c function. Based on methodologies employed in similar studies:

  • Create precise deletion mutants: Use homologous recombination to create complete gene knockouts, confirming deletion by PCR and sequencing.

  • Measure growth parameters: Systematically assess growth rate, cell size, and doubling time. Previous studies of S. pombe deletion mutants have carefully quantified these parameters (e.g., cell size measurements of 160.3 ± 18.4 μm³ for SPAC27E2.03c mutants) .

  • Analyze cell cycle progression: Flow cytometry can determine if the SPAC227.03c deletion affects specific cell cycle phases. Most gene deletions in previous studies maintained wild-type cell cycle distributions, with exceptions showing extended G1 phases .

  • Assess phenotypic effects: Examine cellular morphology, mitochondrial network integrity, and response to various stressors (oxidative, metabolic, temperature).

  • Test genetic interactions: Perform synthetic genetic array analysis to identify genes that interact functionally with SPAC227.03c, potentially revealing parallel or compensatory pathways.

If SPAC227.03c functions similarly to other mitochondrial carriers, its deletion might affect specific metabolic pathways, mitochondrial membrane potential, or cellular responses to metabolic stress, providing crucial insights into its biological role.

How can cross-species comparative genomics help characterize the function of SPAC227.03c?

Cross-species comparative genomics provides powerful insights for characterizing uncharacterized proteins like SPAC227.03c:

  • Ortholog identification beyond sequence similarity: While traditional methods rely heavily on sequence homology, functional orthology doesn't always correlate perfectly with sequence similarity due to evolutionary phenomena like sub- and neo-functionalization . For mitochondrial carriers, structural conservation often exceeds sequence conservation.

  • Integration of expression data across species: Methods that merge microarray datasets on the basis of co-expression can reveal functional relationships without requiring orthology information . This approach is particularly valuable for mitochondrial carriers, which may have diverged in sequence but maintained functional conservation.

  • Iterative non-greedy algorithms: Applying computational approaches that combine co-inertia analysis, back-transformation, Hungarian matching, and majority voting can maximize co-structure identification between datasets from different species .

  • Functional validation across species: Once potential orthologs are identified, complementation studies can test functional conservation by expressing the human ortholog in S. pombe deletion mutants.

This methodological framework allows researchers to leverage evolutionary conservation to predict SPAC227.03c function and identify its potential role in human health and disease, particularly given that S. pombe mitochondrial biology closely resembles that of humans .

What techniques are most effective for studying protein-protein interactions involving SPAC227.03c?

Studying protein-protein interactions of membrane proteins like mitochondrial carriers requires specialized approaches:

  • Proximity-dependent biotin labeling (BioID/TurboID): These methods are particularly effective for transient or weak interactions common in membrane transport proteins. The carrier protein is fused to a biotin ligase that biotinylates nearby proteins, which are then purified and identified by mass spectrometry.

  • Split-protein complementation assays: Techniques like bimolecular fluorescence complementation (BiFC) can visualize interactions in vivo, providing spatial information about where in the mitochondria the interactions occur.

  • Co-immunoprecipitation with crosslinking: Chemical crosslinking can stabilize transient interactions before immunoprecipitation, crucial for capturing the typically dynamic interactions of carrier proteins.

  • Genetic interaction screens: Synthetic genetic array (SGA) analysis can identify functional relationships by examining growth phenotypes of double mutants.

  • Computational prediction: Network analysis incorporating co-expression data can predict potential interaction partners based on expression pattern similarities identified through tools like PCAanalysis() and HCPCanalysis() .

TechniqueAdvantagesLimitationsBest Application
BioID/TurboIDIdentifies transient interactions, works in native contextNon-specific labeling possibleComprehensive interactome mapping
BiFCVisualizes interactions in vivoMay stabilize transient interactions artificiallyConfirming specific interactions
Co-IP with crosslinkingCan capture weak interactionsMay introduce artifactsValidating predicted interactions
Genetic screensIdentifies functional relationshipsIndirect interactions includedDiscovering pathway connections
Computational predictionHigh-throughput, guides wet-lab experimentsRequires validationInitial hypothesis generation

How does the overexpression of SPAC227.03c affect cellular phenotypes compared to deletion?

Comparing overexpression and deletion phenotypes provides complementary insights into protein function:

  • Overexpression system selection: The nmt1 promoter system in S. pombe offers three strengths (strong, medium, weak) for titrated expression levels, allowing researchers to manage potential toxicity while ensuring sufficient expression for phenotypic effects.

  • Cell size and morphology assessment: Previous studies of cell cycle regulators found that overexpression of certain genes caused cell elongation . Researchers should systematically measure cell length, width, and volume in both overexpression and deletion strains.

  • Cell cycle analysis: Flow cytometry can determine if SPAC227.03c overexpression causes cell cycle phase distribution shifts, while time-lapse microscopy can reveal specific cell cycle timing defects.

  • Mitochondrial network analysis: Confocal microscopy with mitochondrial markers can assess changes in mitochondrial morphology, number, and distribution resulting from SPAC227.03c overexpression.

  • Metabolic profiling: Comparative metabolomics between overexpression, deletion, and wild-type strains can identify metabolic pathways affected by SPAC227.03c activity.

This bidirectional approach (loss- and gain-of-function) allows researchers to distinguish between direct effects of SPAC227.03c activity versus compensatory responses to its absence, providing more robust functional insights.

How can transcriptomic analysis help place SPAC227.03c in a functional context?

Transcriptomic analysis provides crucial insights for contextualizing SPAC227.03c within broader cellular networks:

  • Temporal expression profiling: Using time-series RNA-seq data to track expression changes during cell cycle progression, stress responses, or metabolic shifts can reveal when SPAC227.03c is most active .

  • Co-expression network analysis: Identifying genes with expression patterns similar to SPAC227.03c can reveal functional relationships and potential regulatory connections. Tools like MFUZZanalysis() can cluster genes with similar temporal expression profiles .

  • Differential expression following perturbations: Analyzing transcriptome-wide changes after deleting or overexpressing SPAC227.03c can identify downstream effects and potential pathways influenced by this carrier.

  • Cross-condition meta-analysis: Examining SPAC227.03c expression across diverse experimental conditions can identify specific stimuli that regulate its expression, providing functional clues.

  • Integration with other mitochondrial datasets: Comparing SPAC227.03c expression patterns with known mitochondrial genes can help determine if it functions in specific mitochondrial processes (e.g., OXPHOS, mitochondrial translation) .

The MultiRNAflow R package provides a comprehensive framework for such analyses, offering tools for normalization, factorial analysis, temporal clustering, and differential expression analysis that can be directly applied to studying SPAC227.03c in various experimental contexts .

What methodological considerations are important when purifying and characterizing recombinant SPAC227.03c?

Purifying membrane proteins like mitochondrial carriers presents unique challenges requiring specialized approaches:

  • Expression system selection: While E. coli is commonly used, eukaryotic systems like insect cells or yeast may better support proper folding and post-translational modifications of mitochondrial membrane proteins.

  • Solubilization strategies: Test multiple detergents (DDM, LMNG, digitonin) at various concentrations to identify optimal conditions for extracting SPAC227.03c from membranes while maintaining native structure.

  • Purification tag placement: Consider both N- and C-terminal tags, as carrier proteins often have termini exposed to different compartments. Cleavable tags allow removal after purification to minimize functional interference.

  • Stability enhancement: Include cardiolipin in purification buffers, as this lipid often stabilizes mitochondrial carriers. Consider nanodiscs or amphipols for final reconstitution to maintain native-like lipid environment.

  • Functional validation: Develop transport assays using liposome reconstitution to determine substrate specificity and transport kinetics.

Purification StepCritical ParametersTroubleshooting Approaches
ExpressionTemperature, induction conditionsTest reduced temperatures, different induction levels
SolubilizationDetergent type and concentrationScreen detergent panel, add glycerol as stabilizer
Affinity purificationBuffer composition, salt concentrationOptimize imidazole gradients, add specific lipids
Size exclusionFlow rate, buffer compositionAnalyze monodispersity, adjust detergent concentration
ReconstitutionLipid composition, protein:lipid ratioVary lipid mixtures, test different reconstitution methods

These methodological considerations are essential for obtaining functionally active SPAC227.03c, which is prerequisite for biochemical characterization and substrate identification.

How can metabolomic approaches help identify the substrates transported by SPAC227.03c?

Identifying substrates for uncharacterized mitochondrial carriers requires a systematic metabolomic approach:

  • Comparative metabolic profiling: Analyze intracellular and mitochondrial metabolite levels in wild-type versus SPAC227.03c deletion strains. Substrates of the carrier will likely show accumulation on one side of the mitochondrial membrane and depletion on the other.

  • Isotope labeling studies: Use stable isotope-labeled metabolites (¹³C, ¹⁵N) to track metabolite movement across mitochondrial membranes in the presence and absence of SPAC227.03c.

  • Direct transport assays: Reconstitute purified SPAC227.03c into liposomes and measure transport of candidate substrates using radiolabeled compounds or fluorescent probes.

  • Metabolic flux analysis: Apply flux balance analysis to identify metabolic pathways disrupted in SPAC227.03c mutants, providing clues to potential substrates.

  • In silico substrate prediction: Utilize structural modeling and molecular docking to predict potential substrates based on binding site characteristics, particularly if homology to characterized carriers exists.

This multi-faceted approach increases the likelihood of identifying the physiological substrate(s) of SPAC227.03c, which is essential for understanding its role in mitochondrial and cellular metabolism.

How does research on SPAC227.03c contribute to our understanding of human mitochondrial diseases?

Research on SPAC227.03c has significant implications for human health due to several factors:

  • Evolutionary conservation: S. pombe mitochondrial biology closely resembles human mitochondrial processes, making findings potentially translatable to human health . The machinery for mitochondrial gene expression is structurally and functionally conserved between fission yeast and humans.

  • Model system advantages: S. pombe provides experimental accessibility while maintaining core mitochondrial functions similar to human cells, including mitochondrial inheritance patterns, transport mechanisms, and genome organization .

  • Disease relevance: Mitochondrial carriers are implicated in numerous human diseases. Characterizing SPAC227.03c can provide insights into the function of human orthologs potentially involved in mitochondrial disorders.

  • Therapeutic target identification: Understanding the function and regulation of mitochondrial carriers can reveal new intervention points for mitochondrial diseases, which currently have limited treatment options.

By leveraging the advantages of S. pombe as a model organism and applying advanced multi-omics approaches, researchers studying SPAC227.03c contribute to the broader understanding of mitochondrial carrier function, with direct implications for human mitochondrial disease research and potential therapeutic development .

What are the most promising future research directions for SPAC227.03c characterization?

Future research on SPAC227.03c should expand in several promising directions:

  • Comprehensive interactome mapping: Apply proximity labeling techniques to identify the complete protein interaction network of SPAC227.03c in different cellular conditions.

  • Structural characterization: Pursue cryo-EM or X-ray crystallography studies to determine the three-dimensional structure, providing insights into substrate binding and transport mechanisms.

  • Conditional regulation studies: Investigate how SPAC227.03c activity is regulated under different metabolic conditions, potentially revealing its role in metabolic adaptation.

  • Cross-species functional complementation: Test whether human orthologs can rescue SPAC227.03c deletion phenotypes, establishing functional conservation across evolution.

  • Integration with mitochondrial dynamics: Explore how SPAC227.03c function relates to mitochondrial fusion, fission, and quality control mechanisms, particularly under stress conditions.

  • Development of small molecule modulators: Design and screen for compounds that can specifically inhibit or activate SPAC227.03c to create chemical tools for studying its function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.