Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C27B12.09c (pi069, SPBC27B12.09c)

What is the C27B12.09c mitochondrial carrier protein in S. pombe?

The C27B12.09c (pi069, SPBC27B12.09c) is an uncharacterized mitochondrial carrier protein in Schizosaccharomyces pombe with UniProt accession number O13660. This 277-amino acid protein belongs to the mitochondrial carrier family, which typically facilitates the transport of metabolites, nucleotides, and cofactors across the inner mitochondrial membrane. The full amino acid sequence is: MDQAIAGLAAGTASTLIMHPLDLAKIQMQASMNQDSKSLFQVFKSNIGSNGSIRSLYHGLSINVLGSAASWGAYFCIYDFSKRVVMSMTPFNNGEISVLQTLCSSGFAGCIVAALTNPIWVVKSRILSKRVNYTNPFFGFYDLIKNEGLRGCYAGFAPSLLGVSQGALQFMAYEKLKLWKQRRPTSLDYIFMSAASKVFAAVNMYPLLVIRTRLQVMRSPHRSIMNLVLQTWRLQGILGFYKGFLPHLLRVVPQTCITFLVYEQVGMHFKTQSSKSQ .

Why is S. pombe considered an important model organism for mitochondrial research?

S. pombe (fission yeast) serves as an excellent model for mitochondrial research due to its remarkable similarities to human cells in several key aspects: mitochondrial inheritance patterns, mitochondrial transport mechanisms, sugar metabolism pathways, mitogenome structure, and dependence on the mitogenome for viability (petite-negative phenotype). Additionally, the machinery for mitochondrial gene expression is structurally and functionally conserved between fission yeast and humans. S. pombe's experimental tractability, with numerous established techniques and database resources, makes it particularly valuable for both biomedical and fundamental research on mitochondrial function .

How does the mitochondrial genome organization in S. pombe compare to humans?

The mitochondrial genome organization in S. pombe shares significant similarities with human mitochondria. Both produce only a few polycistronic transcripts that undergo processing according to the tRNA punctuation model. This conservation extends to the machinery for mitochondrial gene expression, making findings in S. pombe potentially translatable to human mitochondrial biology. Unlike Saccharomyces cerevisiae, which can survive without functional mitochondrial DNA, S. pombe exhibits a petite-negative phenotype similar to humans, meaning it requires functional mitochondrial DNA for viability .

What are the optimal conditions for expressing recombinant C27B12.09c protein in laboratory settings?

For optimal expression of recombinant C27B12.09c protein, researchers should consider a systematic approach that leverages S. pombe's genetic tractability:

• Expression System Selection: While E. coli systems offer simplicity, expressing in S. pombe itself helps maintain proper folding and post-translational modifications critical for mitochondrial proteins.

• Vector Construction:

  • For bacterial expression: pET vectors with His-tags facilitate purification

  • For S. pombe expression: pREP vectors with nmt1 promoters provide thiamine-repressible expression control

• Growth Conditions:

  • Temperature: 30°C for S. pombe cultures

  • Medium: EMM (Edinburgh Minimal Medium) for controlled expression

  • Induction time: 16-24 hours for nmt1 promoter systems

• Purification Strategy:

  • Initial centrifugation at 3,000g to collect cells

  • Mitochondrial isolation using differential centrifugation

  • Membrane protein extraction with mild detergents (0.5-1% DDM or CHAPS)

  • Affinity chromatography followed by size exclusion chromatography

Optimization of these conditions should be performed iteratively, with protein yield and functional verification at each step .

How should researchers design experiments to investigate the functional characteristics of the uncharacterized C27B12.09c protein?

Designing experiments to characterize C27B12.09c functionality requires a multi-faceted approach:

• Sequence Analysis and Structural Prediction:

  • Bioinformatic analysis comparing C27B12.09c with characterized mitochondrial carriers

  • Secondary structure prediction to identify transmembrane domains

  • Homology modeling to predict substrate binding sites

• Localization Studies:

  • GFP fusion constructs to confirm mitochondrial localization

  • Submitochondrial fractionation to determine inner membrane integration

  • Protease protection assays to establish membrane topology

• Deletion and Complementation Studies:

  • Generate C27B12.09c deletion strains using homologous recombination

  • Assess phenotypic consequences on mitochondrial function and cell viability

  • Complementation with wild-type and mutant alleles

• Transport Assays:

  • Reconstitution in liposomes with potential substrates

  • Radioisotope flux measurements

  • Membrane potential measurements across proteoliposomes

• Interaction Studies:

  • Co-immunoprecipitation to identify binding partners

  • Tandem affinity purification followed by mass spectrometry

  • Yeast two-hybrid screening

This comprehensive experimental design allows for systematic investigation of an uncharacterized mitochondrial carrier from multiple angles .

What synchronization methods for S. pombe cultures yield the most consistent results for mitochondrial protein studies?

Synchronization of S. pombe cultures is critical for studying the temporal aspects of mitochondrial protein expression and function. Two primary methods yield consistent results:

• Temperature-sensitive pat1-114 Method:

  • Culture pat1-114 mutant cells (homozygous for h⁺ or h⁻) to mid-log phase at permissive temperature (25°C)

  • Nitrogen starvation for 14-16 hours

  • Temperature shift to 34°C with nitrogen readdition

  • Results in highly synchronous progression (~70-80% synchrony)

  • Advantages: Higher synchrony; predictable timing of cellular events

  • Limitations: Temperature shift may affect some mitochondrial processes

• Nitrogen Starvation Method for Diploid Cells:

  • Culture h⁺/h⁻ diploid cells in minimal medium to mid-log phase

  • Transfer to nitrogen-free medium

  • Advantages: More physiological; avoids temperature shift artifacts

  • Limitations: Lower synchrony (~50-60%); longer induction time

For mitochondrial carrier studies, the nitrogen starvation method is often preferred despite lower synchrony because it avoids temperature-induced mitochondrial stress that could confound results. Sample collection at 30-minute intervals for the first 6 hours allows capturing most relevant expression changes .

How can researchers distinguish between primary and secondary effects of C27B12.09c deletion on mitochondrial function?

Distinguishing primary from secondary effects in C27B12.09c deletion studies requires a sophisticated experimental approach:

• Temporal Analysis:

  • Implement an inducible degron system for rapid protein depletion

  • Monitor mitochondrial parameters at short time intervals post-depletion

  • Early changes (0-4 hours) likely represent primary effects

  • Later changes (>8 hours) often reflect secondary adaptations

• Metabolomic Profiling:

  • Conduct untargeted metabolomics at multiple timepoints after depletion

  • Compare changes in related metabolic pathways

  • Primary effects show immediate metabolite accumulation/depletion

• Complementation Series:

  • Create a library of partial function mutants

  • Complementation with specific functional domains

  • Correlation analysis between functional rescue and phenotypic parameters

• Multi-omics Integration:

  • Combine proteomics, transcriptomics, and metabolomics data

  • Apply pathway and network analysis algorithms

  • Identify direct molecular interactions versus downstream pathway effects

This approach allows researchers to establish causality rather than mere correlation in phenotypic observations .

What are the most informative comparative analyses between C27B12.09c and human mitochondrial carriers?

Comparative analyses between C27B12.09c and human mitochondrial carriers should be structured to maximize translational insights:

• Sequence-Structure-Function Relationships:

  • Multiple sequence alignment with all 53 human mitochondrial carrier family members

  • Focus on conserved substrate-binding sites and signature motifs

  • Quantitative conservation scoring of functional domains

• Heterologous Expression Studies:

  • Express human mitochondrial carriers in C27B12.09c deletion strains

  • Test for functional complementation

  • Identify closest functional human orthologs

• Evolutionary Analysis:

  • Reconstruct phylogenetic relationships between fungal and human carriers

  • Identify selection pressures on specific protein domains

  • Map functional divergence to evolutionary events

• Disease-Associated Variants:

  • Model human disease-associated variants in the S. pombe protein

  • Assess functional consequences in the simplified yeast system

  • Validate findings in human cell models

• Substrate Specificity Comparison:

  • Perform comparative transport assays with recombinant proteins

  • Determine kinetic parameters (Km, Vmax) for shared substrates

  • Map substrate selectivity to specific structural elements

These analyses create a robust framework for leveraging S. pombe studies to inform human mitochondrial biology and disease mechanisms .

How do mitochondrial carrier proteins like C27B12.09c contribute to the petite-negative phenotype in S. pombe?

The relationship between mitochondrial carrier proteins and the petite-negative phenotype in S. pombe involves complex cellular dependencies:

• Metabolic Essentiality Hypothesis:

  • Mitochondrial carriers facilitate transport of essential metabolites

  • Disruption of specific carriers may prevent cytosolic-mitochondrial metabolite exchange

  • Certain metabolic intermediates become trapped or depleted

  • This creates non-viable metabolic states even with fermentable carbon sources

• Membrane Potential Maintenance:

  • Some carriers participate in maintaining mitochondrial membrane potential

  • Carrier-mediated exchange contributes to proton gradient independent of respiratory chain

  • Disruption may collapse membrane potential required for protein import

  • Results in catastrophic loss of mitochondrial function

• Retrograde Signaling Defects:

  • Carriers may transport signaling molecules between compartments

  • Disruption prevents appropriate nuclear response to mitochondrial dysfunction

  • Unlike S. cerevisiae, S. pombe may lack alternative retrograde pathways

  • Cells cannot adapt to mitochondrial genome loss

• Evidence from Comparative Studies:

  • Experimental data indicates differential expression of mitochondrial carriers between petite-positive and petite-negative yeasts

  • Forced expression of specific carriers from S. cerevisiae can partially rescue petite-negativity

  • C27B12.09c may represent one of the critical carriers maintaining this dependency

Understanding this relationship has significant implications for human mitochondrial diseases, as humans also exhibit a petite-negative phenotype .

What statistical approaches are most appropriate for analyzing variability in C27B12.09c expression experiments?

• For RT-qPCR Expression Data:

  • Normalization: Use multiple reference genes (act1, cdc2, and pda1) with geNorm algorithm

  • Test for normality using Shapiro-Wilk test prior to selecting parametric/non-parametric tests

  • For time-course experiments: Mixed-effects models with time as fixed effect and experimental replicate as random effect

  • For dose-response: Non-linear regression with four-parameter logistic models

  • Minimum biological replicates: n=4 for adequate statistical power

• For Protein Quantification:

  • Western blot densitometry: ANCOVA with total protein normalization as covariate

  • Mass spectrometry: Linear mixed-effects models with empirical Bayes moderation

  • Account for technical variation using nested random effects

  • Data transformation: Log2 transformation for heteroscedastic data

• For Functional Assays:

  • Transport assays: Michaelis-Menten or Hill equation fitting with extra sum-of-squares F-test for comparing models

  • Growth assays: Area under curve (AUC) analysis rather than endpoint measurements

  • Survival analysis techniques for time-to-event data

• Experimental Design Considerations:

  • Power analysis prior to experimentation: Aim for 80% power to detect 1.5-fold changes

  • Include biological and technical replicates with nested design

  • Incorporate randomization and blinding where possible

  • Use positive and negative controls in every experimental batch

Implementing these rigorous statistical approaches will minimize both Type I and Type II errors when interpreting C27B12.09c experimental data .

How should researchers interpret seemingly contradictory findings between in vitro and in vivo studies of C27B12.09c function?

Reconciling contradictory findings between in vitro and in vivo studies requires systematic evaluation of experimental contexts:

• Context-Dependent Functionality Assessment:

  • Map discrepancies to specific experimental parameters

  • Evaluate protein modifications present in vivo but absent in vitro

  • Consider cellular compartmentalization effects missing in purified systems

  • Assess concentration differences between reconstituted systems and physiological conditions

• Methodological Reconciliation Framework:

  • Bridge gaps with intermediate experimental systems

  • Semi-intact cell preparations maintain cellular organization

  • Isolated mitochondria preserve organelle integrity

  • Permeabilized cells allow controlled substrate access

• Common Sources of Discrepancy and Solutions:

• Integrated Model Development:

  • Develop testable hypotheses that explain both sets of results

  • Design experiments specifically addressing the discrepancy

  • Consider multifactorial regulation beyond single-variable effects

  • Implement systems biology approaches to model complex interactions

This structured approach transforms contradictory findings into opportunities for deeper mechanistic understanding of C27B12.09c function .

What are the most common pitfalls in experimental design when studying uncharacterized mitochondrial carriers, and how can they be avoided?

Experimental design for uncharacterized mitochondrial carriers presents several potential pitfalls that require specific preventive strategies:

• Substrate Identification Challenges:

  • Pitfall: Restricting substrate screening to predicted candidates

  • Prevention: Implement unbiased metabolomic approaches comparing metabolite profiles in deletion vs. wild-type strains; perform comprehensive transport assays with metabolite libraries

• Functional Redundancy Issues:

  • Pitfall: Overlooking compensatory mechanisms masking phenotypes

  • Prevention: Generate multiple carrier deletion strains; use inducible systems for acute protein depletion; perform epistasis analysis with related carriers

• Artificial Expression Effects:

  • Pitfall: Phenotypes from non-physiological expression levels

  • Prevention: Use native promoters with tagged proteins; calibrate inducible systems to match endogenous levels; compare multiple expression systems

• Environmental Variable Control:

  • Pitfall: Inconsistent results due to uncontrolled variables

  • Prevention: Standardize growth conditions (temperature, media composition, pH, oxygen levels); monitor growth phase carefully; establish consistent harvesting procedures

• Membrane Protein Solubilization Issues:

  • Pitfall: Protein denaturation during extraction and purification

  • Prevention: Screen multiple detergents at varying concentrations; consider native nanodiscs or styrene maleic acid lipid particles (SMALPs); validate protein folding with circular dichroism

• In Vitro Reconstitution Artifacts:

  • Pitfall: Artificial liposome composition affecting function

  • Prevention: Match lipid composition to mitochondrial inner membrane; test multiple lipid mixtures; include cardiolipin at physiological concentrations

• Technical Controls and Validation:

  • Pitfall: Insufficient validation of experimental tools

  • Prevention: Validate antibody specificity with deletion strains; confirm tagged protein functionality; include substrate-free and protein-free controls in transport assays

Implementing these preventive strategies creates robust experimental designs that generate reliable and reproducible results when characterizing novel mitochondrial carriers like C27B12.09c .

What emerging technologies hold the most promise for elucidating the structure-function relationship of mitochondrial carriers like C27B12.09c?

Several cutting-edge technologies are poised to revolutionize mitochondrial carrier research:

• Cryo-Electron Microscopy Advances:

  • Single-particle analysis at near-atomic resolution

  • Visualization of carriers in different conformational states

  • Sample preparation innovations for membrane proteins

  • Potential for structure determination without crystallization

• Integrative Structural Biology Approaches:

  • Combining cryo-EM with molecular dynamics simulations

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Cross-linking mass spectrometry for mapping interaction interfaces

  • Integrative modeling incorporating sparse experimental constraints

• In-Cell Structural Biology:

  • FRET-based sensors for conformational changes in living cells

  • In-cell NMR for studying protein dynamics in native environment

  • Proximity labeling methods (BioID, APEX) for mapping interaction networks

  • Super-resolution microscopy for visualizing carrier distribution and clustering

• Artificial Intelligence Applications:

  • Deep learning for structure prediction (AlphaFold2, RoseTTAFold)

  • Machine learning for functional annotation from sequence

  • Neural networks for predicting substrate specificity

  • Graph neural networks for modeling transport kinetics

• Gene Editing and High-Throughput Phenotyping:

  • CRISPR-Cas9 screens for comprehensive functional mapping

  • Deep mutational scanning for structure-function correlations

  • Automated phenotyping platforms for large-scale functional studies

  • Single-cell transcriptomics to capture heterogeneous responses

These technologies, especially when used in combination, offer unprecedented opportunities to resolve the molecular mechanisms of mitochondrial carriers like C27B12.09c .

How might understanding C27B12.09c function contribute to therapeutic approaches for human mitochondrial diseases?

The translational potential of C27B12.09c research extends to several therapeutic strategies for mitochondrial diseases:

• Identification of Functional Orthologs:

  • Establishing clear orthology relationships through complementation studies

  • Mapping disease-causing mutations onto conserved functional domains

  • Understanding species-specific adaptations that could inform therapeutic design

• Drug Discovery Platforms:

  • Development of S. pombe screening systems for compound libraries

  • Identification of molecules that can modulate carrier function

  • Testing carrier-stabilizing compounds in disease models

  • High-throughput assays for substrate transport modulation

• Genetic Therapy Development Pipeline:

  • S. pombe as a testbed for genetic interventions

  • Evaluation of gene replacement strategies

  • Testing RNA-based therapeutics for enhancing carrier expression

  • Assessing suppressor mutations that rescue carrier dysfunction

• Metabolic Bypass Strategies:

  • Identifying alternative metabolic pathways that circumvent specific carrier requirements

  • Engineering synthetic transporters with modified substrate specificity

  • Developing membrane-permeable metabolic intermediates

  • Testing metabolic interventions in S. pombe disease models before mammalian studies

• Biomarker Development:

  • Metabolomic signatures of carrier dysfunction for early diagnosis

  • Correlation of metabolite profiles with disease progression

  • Identification of conserved stress responses as therapeutic targets

By leveraging the experimental tractability of S. pombe and the evolutionary conservation of mitochondrial carriers, researchers can accelerate the development of targeted interventions for human mitochondrial diseases .