Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C29A3.11c (SPBC29A3.11c)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Expression

SPBC29A3.11c is located on chromosome II of S. pombe. Transcriptomic studies reveal differential expression under nutrient stress and developmental conditions:

Expression Profile

ConditionFold Changep-valueSource
Anacardic Acid Stress-2.505.79E-03
Stationary Phase+3.202.79E-03

The gene is co-expressed with metabolic regulators like php2 (CCAAT-binding factor) and sen1 (RNA helicase) .

Functional Hypotheses

While uncharacterized experimentally, homology and systems biology analyses suggest roles in:

  • Metabolite Transport: Likely transports small molecules (e.g., nucleotides, amino acids) across the mitochondrial inner membrane, similar to SLC25A family carriers .

  • Redox Homeostasis: Potential involvement in sulfur metabolism or glutathione transport, inferred from interaction networks with ctr4 (copper transporter) .

Phenotypic Associations

Functional genomics links SPBC29A3.11c to stress adaptation:

Mutant Phenotypes

ConditionPhenotypeGenetic Interaction
Oxidative StressSensitivityphp5 (CCAAT complex)
Carbon LimitationResistancesfp1 (transcription factor)

Comparative Analysis with Canonical Mitochondrial Carriers

SPBC29A3.11c shares structural homology with characterized carriers but lacks direct functional overlap:

Carrier FamilySubstratesDisease Association
SLC25A3 (PiC)Phosphate, H⁺Myopathy, lactic acidosis
SLC25A10 (DIC)DicarboxylatesOxidative stress
SPBC29A3.11cUnknownNone reported

Research Gaps and Future Directions

  • Substrate Identification: Reconstitution assays in proteoliposomes are needed to define transport activity .

  • Pathogenic Potential: No disease associations are reported, but mutations in analogous carriers (e.g., SLC25A1) cause severe metabolic disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SPBC29A3.11c; Uncharacterized mitochondrial carrier C29A3.11c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC29A3.11c
Target Protein Sequence
MGLPVHNQPHKAHSGSPASTFSAALVSSAISNVIGYPLDSIKVRQQTYNFPTIRSCFQNA VKNEGLKGLYRGLTLPLISATLSRSVSFTVYDSLKLTFAHVDPTLRYFISGLGTGTFISL FACPFEYSKLYSQIDMLLRKTNMGRRQETNSKLSVRPPLSSFQSASDIVRRYGFTALWNG YRYHLTRDALGSACYFTIYETFKKNLIANDVKPHFAYAFSGAFCGALSWILVFPVDTAKS IVQRNTLLSIKTPLSSIPWLSFTIYRGIGISLMRSALINSCNFTLFELFRETKVLSK
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What experimental approaches are recommended for determining SPBC29A3.11c function?

    Multiple complementary approaches should be employed to determine the function of this uncharacterized carrier:

    1. Gene deletion and phenotypic analysis: Create a ΔSPBC29A3.11c strain and assess growth under various conditions (different carbon sources, stress conditions) .

    2. Localization confirmation: Use GFP or epitope tagging to confirm mitochondrial localization and submitochondrial distribution .

    3. Transport assays: Reconstitute the purified recombinant protein into liposomes to measure transport of potential substrates.

    4. Metabolomic profiling: Compare metabolite levels in wild-type and ΔSPBC29A3.11c strains to identify accumulated or depleted metabolites.

    5. Suppressor screens: Identify genetic suppressors of phenotypes associated with SPBC29A3.11c deletion.

    6. Comparative analysis: Study the effects of deleting similar carriers (like SPAC19G12.05) to identify potential functional overlap .

  • How can researchers study the interaction partners of SPBC29A3.11c?

    To identify interaction partners of SPBC29A3.11c, implement the following complementary strategies:

    1. Affinity purification-mass spectrometry (AP-MS): Tag SPBC29A3.11c with epitopes (e.g., TAP-tag, FLAG, or Myc) and purify protein complexes under native conditions. This approach has been successfully used for other mitochondrial proteins in S. pombe .

    2. Proximity labeling: Use BioID or APEX2 fused to SPBC29A3.11c to label proximal proteins in the mitochondrial environment.

    3. Yeast two-hybrid screening: Although challenging for membrane proteins, modified membrane yeast two-hybrid systems can be used.

    4. Co-immunoprecipitation validation: Confirm specific interactions identified through other methods.

    5. Genetic interaction screens: Conduct synthetic genetic array (SGA) analysis to identify genes whose deletion enhances or suppresses phenotypes of SPBC29A3.11c deletion .

    Proteomic studies have previously shown that mitochondrial proteins often co-purify with subsets of mitoribosomal proteins, as observed with Ppr10 and Mpa1 .

  • What is the relevance of SPBC29A3.11c to mitochondrial translation?

    While SPBC29A3.11c's direct role in mitochondrial translation is unknown, research on other S. pombe mitochondrial proteins provides context:

    1. Mitochondrial carriers may influence translation by transporting metabolites needed for protein synthesis.

    2. Some mitochondrial proteins, like Ppr10 and Mpa1, function together to mediate mitochondrial translational initiation in S. pombe .

    3. Disruption of mitochondrial carriers can impair association of mitochondrial mRNAs (like cob1 and cox1) with assembled mitochondrial ribosomes .

    4. The association of translational initiation factors Mti2 and Mti3 with the mitochondrial small subunit (mt-SSU) can be affected by disruption of other mitochondrial proteins .

    To investigate potential roles in translation, researchers should examine:

    • Changes in mitochondrial protein synthesis in ΔSPBC29A3.11c strains

    • Association of mitochondrial mRNAs with ribosomes

    • Interactions with known translation factors

  • How does SPBC29A3.11c compare to other mitochondrial carriers in S. pombe?

    S. pombe contains multiple mitochondrial carriers with various functions. Comparative analysis reveals:

    Carrier ProteinSystematic NamePredicted FunctionEssentialPhenotype When Deleted
    SPBC29A3.11cSPBC29A3.11cUncharacterizedNoNot fully characterized
    SPAC19G12.05SPAC19G12.05Mitochondrial citrate transporter (predicted)NoNot fully characterized
    Anc1-ADP/ATP carrierYes-
    Pet801-S-adenosylmethionine transporterNoRespiratory deficient

    Unlike carriers with established functions, SPBC29A3.11c and similar uncharacterized carriers present research opportunities for novel metabolic pathway discovery .

  • What approaches should be used to characterize respiratory phenotypes in SPBC29A3.11c mutants?

    To thoroughly characterize respiratory phenotypes in SPBC29A3.11c deletion mutants:

    1. Growth assays on different carbon sources: Compare growth on fermentable (glucose) versus non-fermentable (glycerol, ethanol) carbon sources. Respiratory-deficient mutants typically show impaired growth on non-fermentable media .

    2. Oxygen consumption measurements: Use a respirometer to measure oxygen consumption rates in intact cells and isolated mitochondria.

    3. Mitochondrial membrane potential assessment: Use fluorescent dyes (JC-1, TMRM) to assess changes in membrane potential.

    4. Respiratory complex activity assays: Measure the activities of individual respiratory chain complexes in isolated mitochondria.

    5. ROS production measurement: Assess reactive oxygen species levels using fluorescent indicators.

    6. mtDNA stability analysis: Check for mtDNA loss or mutations, especially in genes encoding respiratory complex subunits.

    Researchers studying mitochondrial function in S. pombe have successfully used these approaches to characterize phenotypes of deletion mutants under varying nutrient conditions .

  • How can researchers develop a reliable in vitro transport assay for SPBC29A3.11c?

    Developing a reliable in vitro transport assay requires:

    1. Protein expression and purification: Express recombinant SPBC29A3.11c in E. coli, yeast, or insect cells with appropriate affinity tags. Purify using methods optimized for membrane proteins (detergent solubilization followed by affinity chromatography) .

    2. Liposome reconstitution: Incorporate purified protein into liposomes with defined lipid composition mimicking the mitochondrial inner membrane.

    3. Substrate identification strategy:

      • Begin with common mitochondrial carrier substrates (nucleotides, metabolites, cofactors)

      • Perform comparative sequence analysis with characterized carriers to predict substrates

      • Use metabolomic analysis of deletion mutants to identify candidate substrates

    4. Transport measurement techniques:

      • Radiolabeled substrate uptake assays

      • Fluorescence-based transport assays

      • Counterflow assays for exchange transporters

    5. Kinetic characterization: Determine Km, Vmax, inhibition patterns, and substrate specificity to fully characterize transport properties.

  • What are the recommended approaches for analyzing the effects of SPBC29A3.11c deletion on the mitochondrial proteome?

    To comprehensively analyze the impact of SPBC29A3.11c deletion on the mitochondrial proteome:

    1. Quantitative mitochondrial proteomics:

      • Isolate highly purified mitochondria from wild-type and ΔSPBC29A3.11c strains

      • Use SILAC, TMT, or label-free quantification approaches

      • Apply multidimensional prefractionation techniques (IEF, ion-exchange chromatography) to increase proteome coverage

    2. Analysis of protein complexes:

      • Blue native PAGE to examine respiratory complexes and other mitochondrial complexes

      • Sucrose gradient sedimentation to analyze ribosome assembly and other large complexes

    3. Post-translational modification analysis:

      • Phosphoproteomics to identify changes in signaling

      • Acetylome analysis for metabolic regulation

    4. Targeted analysis of key pathways:

      • Western blotting for selected marker proteins

      • Enzymatic activity assays for respiratory complexes

    Previous proteomics studies in S. pombe achieved identification of ~2000 proteins, including mitochondrial carriers and ribosomal proteins, using multidimensional prefractionation .

  • How can researchers integrate SPBC29A3.11c research with broader studies of mitochondrial function in S. pombe?

    Integration strategies should include:

    1. Comparative genomics: Analyze conservation patterns of SPBC29A3.11c across fungi and potentially other eukaryotes to predict functional importance .

    2. Network analysis: Place SPBC29A3.11c in the context of known mitochondrial functional networks using existing protein-protein interaction and genetic interaction data.

    3. Multi-omics integration: Combine proteomics, transcriptomics, and metabolomics data to build a comprehensive model of SPBC29A3.11c function .

    4. Comparative mutant phenotyping: Compare phenotypes of SPBC29A3.11c deletion with other mitochondrial carrier deletions under various growth conditions .

    5. Drug sensitivity profiling: Test sensitivity to antifungals targeting ergosterol biosynthesis and other compounds affecting mitochondrial function .

    6. Collaboration with complementary model systems: Compare findings with studies of related carriers in S. cerevisiae or other fungi.

    Such integrated approaches have successfully elucidated functions of previously uncharacterized mitochondrial proteins in S. pombe, as demonstrated in studies of mitochondrial translation factors and RNA processing enzymes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.