Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C83.13 (SPBC83.13) is a mitochondrial protein encoded by the gene SPBC83.13 in fission yeast. While its precise biological function remains unresolved, it belongs to the mitochondrial carrier family (MCF), which facilitates the transport of metabolites, ions, and cofactors across the mitochondrial inner membrane . This protein is produced recombinantly in heterologous systems and is available for research purposes, though its substrate specificity and physiological role require further investigation.
The recombinant protein spans 293 residues, with the following structural features:
| Region | Sequence (Partial) |
|---|---|
| N-Terminal | MSKIEKKQASASNLLLGAGLNLFETSSLGQPLEVTKVQMAANRTQTMAQAIKAIMSRGGILGFYQGLIPWAWIEASTKGAVLLFTSAELEYWGRRLGLGATSAGAIAGMGGGVAQAYATM |
| Middle | GFCTCMKTAEVTRAKQAATGQEVKGTFRVFADLYKEKGIRGINRGVNAVALRQMTNWGSR LALSRFLEKPIRYFTGRTEAEPLTTGQRFVASVSAGALSCWNQPLEVARVEMQSLTKGIQ HSSPGIMQTIMSIYKNNGIKGLYRGAVPRMGLGAYQTFVMVFLADCVRGYLAK |
| C-Terminal | (Truncated; exact C-terminal sequence not fully resolved) |
SPBC83.13 is produced in multiple hosts to accommodate diverse experimental needs:
| Host System | Advantages | Applications |
|---|---|---|
| Yeast | Native folding, post-translational modifications | Structural studies, membrane protein assays |
| E. coli | High yield, cost-effective | Biochemical assays, inhibitor screens |
| Baculovirus | Proper folding for eukaryotic proteins | Functional assays in insect cells |
| Mammalian Cells | Native glycosylation (if applicable) | Studies requiring eukaryotic machinery |
SPBC83.13 is part of the mitochondrial carrier family (SLC25), which includes transporters for:
Metabolites: Pyruvate, citrate, succinate, glyceraldehyde-3-phosphate .
Redox Cofactors: NADH shuttles (e.g., malate-aspartate shuttle) .
While SPBC83.13’s substrate specificity is uncharacterized, its structural homology to canonical carriers suggests potential roles in:
KEGG: spo:SPBC83.13
STRING: 4896.SPBC83.13.1
Confirming mitochondrial localization of SPBC83.13 requires multiple complementary approaches. Begin with fluorescence microscopy using GFP-tagged SPBC83.13 constructs expressed in S. pombe cells. Co-stain with MitoTracker dyes to confirm colocalization with mitochondria. This should be followed by subcellular fractionation and western blotting using antibodies against the tagged protein and known mitochondrial markers. For higher resolution, employ immunogold electron microscopy to visualize the precise submitochondrial localization.
For in vivo protein labeling experiments, grow S. pombe cells to early exponential phase in complete 5% raffinose medium containing 0.1% glucose, then label mitochondrial proteins at 30°C by incubating whole cells with 35S methionine and cysteine for 3 hours in the presence of cycloheximide (10mg/ml) to specifically block cytoplasmic translation . This approach allows selective labeling of mitochondrially synthesized proteins while suppressing cytoplasmic protein synthesis.
For effective expression of recombinant SPBC83.13 in S. pombe, consider the following optimized cloning strategy:
Amplify the SPBC83.13 gene from S. pombe genomic DNA using high-fidelity polymerase.
Design primers with appropriate restriction sites compatible with your chosen expression vector.
For mitochondrial proteins, consider using vectors with strong promoters like nmt1 or adh1.
Include a C-terminal tag (such as His6, FLAG, or GFP) to facilitate purification and detection.
Transform S. pombe cells using lithium acetate method with a heat shock at 42°C.
For purification, lyse cells using glass beads in the presence of protease inhibitors, then solubilize membrane proteins with mild detergents such as DDM or CHAPS. Purify the tagged protein using affinity chromatography followed by size exclusion chromatography to obtain homogeneous protein for further characterization.
Generating a deletion mutant of SPBC83.13 requires precise gene targeting strategies. The most effective approach involves PCR-based gene targeting:
Design primers to amplify a selection marker (e.g., kanamycin or hygromycin resistance) flanked by sequences homologous to regions upstream and downstream of SPBC83.13.
Transform S. pombe with this PCR product using the lithium acetate method.
Select transformants on appropriate media containing the selection agent.
Verify the correct integration and deletion using PCR with primers that anneal outside the targeted locus.
Confirm the absence of SPBC83.13 transcripts using RT-PCR or Northern blotting.
Consider applying genetic interaction screening to identify potential functional relationships. Similar approaches have been used successfully in studying other mitochondrial proteins in S. pombe, as demonstrated in genetic interaction landscape studies . PCR-based deletion is preferable to random mutagenesis as it ensures complete gene ablation.
Given that SPBC83.13 is a putative mitochondrial carrier, focus on phenotypic assays that assess mitochondrial function:
Growth assays on fermentable vs. non-fermentable carbon sources to evaluate respiratory capacity.
Oxygen consumption measurements using a Clark-type electrode to quantify respiratory activity.
Mitochondrial membrane potential assessment using fluorescent dyes like JC-1 or TMRM.
Reactive oxygen species (ROS) detection using dihydroethidium or MitoSOX Red.
ATP production assays to measure energetic capacity.
Additionally, assess mitochondrial morphology using fluorescence microscopy and electron microscopy. Mitochondrial carriers often transport metabolites, so metabolomic profiling using LC-MS/MS may reveal altered metabolite levels in mutants compared to wild-type strains. Document growth rates under various stress conditions (temperature, oxidative stress, etc.) to identify condition-specific phenotypes.
Determining substrate specificity for an uncharacterized mitochondrial carrier requires systematic approaches:
Reconstitution in liposomes: Purify recombinant SPBC83.13 and reconstitute it into liposomes preloaded with potential substrates. Measure substrate exchange rates using radiolabeled or fluorescently labeled compounds.
Metabolomic profiling: Compare metabolite levels in wild-type and SPBC83.13 deletion strains using LC-MS/MS, focusing on mitochondrial metabolites.
Yeast complementation assays: Test if SPBC83.13 can functionally complement known mitochondrial carrier mutants in S. cerevisiae with defined substrate specificities.
In silico prediction: Use sequence homology and structural modeling to identify conserved residues shared with characterized mitochondrial carriers.
The table below shows a systematic approach for substrate testing:
| Substrate Category | Example Compounds | Concentration Range (mM) | Detection Method |
|---|---|---|---|
| Nucleotides | ATP, ADP, AMP | 0.1-10 | Radiolabeled substrate uptake |
| Amino acids | Glutamate, Ornithine | 0.5-20 | HPLC or LC-MS |
| Carboxylic acids | Malate, Citrate | 0.5-20 | Enzymatic assay |
| Cofactors | NAD+, FAD | 0.1-5 | Fluorescence assay |
| Inorganic phosphate | Pi | 1-50 | Colorimetric assay |
To investigate evolutionary conservation of SPBC83.13:
Orthology identification: Use the HGNC Comparison of Orthology Predictions (HCOP) search tool to identify orthologs across species . Combine multiple orthology prediction algorithms for increased confidence.
Multiple sequence alignment: Align SPBC83.13 with identified orthologs using tools like MUSCLE or Clustal Omega to identify conserved domains and residues.
Phylogenetic analysis: Construct phylogenetic trees using maximum likelihood or Bayesian methods to visualize evolutionary relationships.
Functional complementation: Test cross-species complementation by expressing orthologs in the S. pombe SPBC83.13 deletion mutant to assess functional conservation.
Structural comparisons: Use homology modeling to predict the structure of SPBC83.13 and compare with known structures of mitochondrial carriers.
This approach has been successful in identifying functional conservation between S. pombe and S. cerevisiae proteins involved in mitochondrial translation, despite their significant evolutionary divergence, as demonstrated with proteins like Cbp3, Cbp6, and Mss51 .
Given that meiotic processes in S. pombe involve specific DNA break patterns and recombination events , investigating SPBC83.13's potential role in meiosis requires specialized experimental approaches:
Sporulation efficiency analysis: Compare sporulation rates between wild-type and SPBC83.13 deletion strains under nitrogen starvation conditions.
Meiotic DNA break analysis: Detect DNA breaks using pulsed-field gel electrophoresis as described in research on meiotic DNA breaks in S. pombe . Compare the pattern of DNA breaks (which normally appear shortly after premeiotic DNA replication) between wild-type and mutant strains.
Chromatin immunoprecipitation (ChIP): Perform ChIP experiments to determine if SPBC83.13 associates with chromatin during meiosis.
Time-course analysis: Apply a time-series experimental design to monitor expression and localization of SPBC83.13 during meiotic progression .
Genetic interaction studies: Test genetic interactions between SPBC83.13 and known meiotic recombination genes (rec genes) in S. pombe .
To comprehensively map genetic interactions of SPBC83.13:
Synthetic Genetic Array (SGA): Cross SPBC83.13 deletion strain with a library of deletion mutants to identify synthetic lethal or synthetic sick interactions.
E-MAP approach: Apply Epistatic Mini-Array Profile methodology as demonstrated in S. pombe genetic interaction studies . This quantitative approach measures genetic interaction scores to identify both negative and positive genetic interactions.
Suppressor screens: Identify suppressors of SPBC83.13 deletion phenotypes through random mutagenesis or overexpression libraries.
Targeted double mutant analysis: Create double mutants with genes in related pathways, particularly those involved in mitochondrial function.
Based on genetic interaction studies in S. pombe, the following experimental design is recommended:
| Experimental Phase | Technique | Analysis Method | Expected Outcome |
|---|---|---|---|
| Screen design | E-MAP | Interaction score calculation | Comprehensive interaction map |
| Validation | Tetrad dissection | Growth measurement | Confirmation of key interactions |
| Functional grouping | Hierarchical clustering | Gene ontology enrichment | Pathway assignment |
| Mechanistic studies | Double mutant phenotyping | Various phenotypic assays | Functional relationships |
When faced with contradictory results regarding SPBC83.13 function:
Experimental design evaluation: Apply Campbell and Stanley's principles of experimental design to identify potential threats to validity in your experiments . Review both pre-experimental designs and quasi-experimental designs to understand limitations in your approach.
Condition-specific effects: Test the protein's function under diverse conditions (carbon sources, growth phases, stress conditions) to determine if contradictions are due to condition-specific behaviors.
Strain background effects: Verify results in multiple strain backgrounds to rule out genetic background effects.
Technical approach diversification: Apply multiple independent techniques to measure the same parameter (e.g., measuring protein interaction by both co-immunoprecipitation and yeast two-hybrid).
Reconciliation through modeling: Develop a working model that accommodates seemingly contradictory observations, potentially revealing complex regulatory mechanisms.
The most common sources of contradiction in mitochondrial carrier protein studies include subcellular mislocalization of tagged constructs, off-target effects of knockouts, and condition-specific functional shifts.
An integrated approach to characterizing SPBC83.13 should combine:
Transcriptomics: Perform RNA-seq to compare gene expression profiles between wild-type and SPBC83.13 mutants, particularly focusing on genes involved in mitochondrial function.
Proteomics: Use quantitative mass spectrometry to identify changes in the mitochondrial proteome. Compare protein expression levels and post-translational modifications.
Metabolomics: Profile metabolites, especially those related to mitochondrial pathways, using LC-MS or GC-MS.
Mitochondrial translation analysis: Perform in vivo labeling of mitochondrial translation products as described for S. pombe, using 35S methionine and cysteine in the presence of cycloheximide .
Network analysis: Integrate data from multiple omics approaches to build a comprehensive network model of SPBC83.13's role in mitochondrial function.
This multi-omics approach has been successful in characterizing previously unknown functions of mitochondrial proteins in S. pombe, allowing researchers to distinguish between roles in translation versus post-translational processes .