Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier PB17E12.12c (SPAPB17E12.12c)

Shipped with Ice Packs
In Stock

Description

Protein Identification

  • UniProt ID: Q8TFH2

  • Gene Name: SPAPB17E12.12c

  • Sequence Length: 1–317 amino acids (full-length or partial variants)

  • Amino Acid Sequence:
    MQKDKFGPCAPSRIPLLSNDLISMLSGGVAATVSRTAVSPLERMKIIFQVQNNK... (truncated; see for full sequence)

Mitochondrial Carrier System (MCS)

SPAPB17E12.12c belongs to the MCS, which facilitates the transport of metabolites (e.g., amino acids, nucleotides) across mitochondrial membranes . Key features:

  • Transport Mechanism: Predicted to use a conserved "gated pore" structure involving salt-bridge networks .

  • Functional Redundancy: Overlaps with canonical SLC25 carriers like aspartate-glutamate carriers (AGC1/AGC2) .

Substrate Specificity

While uncharacterized, its homology to SLC25 carriers suggests potential roles in:

  • Redox balance regulation (e.g., malate-aspartate shuttle) .

  • Nucleotide or cofactor transport .

Key Uses

  • Biochemical Assays: Substrate transport kinetics .

  • Structural Studies: Cryo-EM or X-ray crystallography (pending full characterization) .

  • Immunoassays: Available as an ELISA antigen .

Future Directions

  1. Functional Characterization: Identify substrates via radiolabeled uptake assays .

  2. Structural Analysis: Resolve 3D architecture to clarify transport mechanisms .

  3. Disease Relevance: Explore links to mitochondrial disorders linked to SLC25 dysfunction .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly include your request in the order notes. We will fulfill your requirement to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipment is preferred, please communicate with us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles to ensure optimal protein integrity.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag type.
Synonyms
SPAPB17E12.12c; Uncharacterized mitochondrial carrier PB17E12.12c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAPB17E12.12c
Target Protein Sequence
MQKDKFGPCAPSRIPLLSNDLISMLSGGVAATVSRTAVSPLERMKIIFQVQNNKEYTSLT STLVKIWNREGLIGFFRGNGTNCLRAFPYGAVQFATFNMLKQRALKNRSHQNLENHERLL FGAIAGAASCATTYPLDIARTRLSIETAGLTSRSLAINNVANNSLKVKPLTLWSTLLYIV QHEGGYPALYNGLPATLLNVVPYVSICFFTFEFCKQKFFSNADLTAFQKLFLGGFTGIIG QTLTFPADVLRRRFQVNRIPGIGHNYKNIKSAIFHIYKTEGINGFFRGYSSNMLKIIPVM SITWYTYETVSKMLHDL
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the optimal storage protocol for Recombinant S. pombe PB17E12.12c protein?

The recombinant protein should be stored at -20°C in its shipping buffer (Tris-based buffer with 50% glycerol). For extended storage periods, maintaining the protein at -80°C is recommended. Working aliquots can be kept at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they lead to protein degradation and loss of activity .

To maximize protein stability, consider these evidence-based protocols:

Storage ConditionTemperatureMaximum DurationExpected Stability
Stock solution-80°C12+ months>95%
Working aliquots-20°C3-6 months>90%
Active experiments4°C1 week>85%

When preparing working aliquots, use small volumes (10-50 μL) to minimize freeze-thaw cycles and maintain protein integrity.

What is known about the structure and basic properties of the PB17E12.12c protein?

PB17E12.12c is classified as an uncharacterized mitochondrial carrier protein consisting of 317 amino acids. The full amino acid sequence is available (UniProt: Q8TFH2) and shows characteristic features of the mitochondrial carrier protein family . The protein contains the signature mitochondrial carrier domains that typically form six transmembrane regions.

The protein's sequence contains a relatively high proportion of hydrophobic amino acids, consistent with its predicted membrane localization. While the exact three-dimensional structure remains unsolved, computational modeling suggests it follows the standard tripartite structure common to mitochondrial carrier proteins with three similar domains each containing two transmembrane helices.

Why is S. pombe a suitable model organism for studying mitochondrial carrier proteins?

S. pombe serves as an excellent model for mitochondrial research due to several key similarities with human cells:

  • Mitochondrial inheritance and transport mechanisms closely resemble those in human cells

  • Sugar metabolism pathways are similar to human systems

  • The mitogenome structure is comparable to that in humans

  • Both demonstrate the petite-negative phenotype (dependence on functional mitochondria for viability)

  • Transcription of the mitochondrial genome produces polycistronic transcripts processed via the tRNA punctuation model, similar to human mitochondrial gene expression

These similarities make findings in S. pombe highly relevant to understanding human mitochondrial function, particularly for carrier proteins that are evolutionarily conserved across eukaryotes .

What purification methods are most effective for isolating the native PB17E12.12c protein from S. pombe cells?

For isolating native PB17E12.12c from S. pombe, a combination of differential centrifugation and affinity chromatography yields the best results. The procedure should be conducted at 4°C to preserve protein integrity.

Step-by-step methodology:

  • Cell lysis: Harvest S. pombe cells in mid-log phase and disrupt using glass beads in a buffer containing 250 mM sucrose, 10 mM HEPES-KOH (pH 7.4), 1 mM EDTA, and protease inhibitors.

  • Mitochondrial isolation: Perform differential centrifugation (1,500g for 5 min to remove cellular debris, followed by 12,000g for 15 min to pellet mitochondria).

  • Membrane protein extraction: Solubilize mitochondrial membranes using 1% digitonin or 0.5% n-dodecyl-β-D-maltoside in extraction buffer.

  • Affinity purification: For tagged versions of the protein, use appropriate affinity resins. For native protein, immunoprecipitation with specific antibodies can be employed.

  • Size exclusion chromatography: As a final purification step to obtain homogeneous protein preparations.

This methodology preserves protein-protein interactions and post-translational modifications that may be lost in recombinant expression systems.

How can I genetically modify S. pombe to study PB17E12.12c function through knockout or overexpression models?

The genetic manipulation of PB17E12.12c in S. pombe can be achieved through several approaches:

Knockout strategy:

  • Use homologous recombination with a deletion cassette containing a selectable marker (e.g., kanMX6 for G418 resistance) flanked by sequences homologous to regions upstream and downstream of the SPAPB17E12.12c gene.

  • Transform the deletion cassette into S. pombe using lithium acetate method.

  • Select transformants on media containing the appropriate antibiotic.

  • Confirm gene deletion by PCR and Southern blotting.

Overexpression strategy:

  • Clone the SPAPB17E12.12c coding sequence into an expression vector with a strong promoter (e.g., nmt1 promoter in pREP vectors).

  • The nmt1 promoter is thiamine-repressible, allowing for controlled expression levels.

  • Include epitope tags (HA, Myc, GFP) for detection and localization studies.

  • Transform into S. pombe and select on appropriate media.

CRISPR-Cas9 approach:
Recent advances allow for CRISPR-Cas9 genome editing in S. pombe, which can be used for precise modifications:

  • Design guide RNAs targeting the SPAPB17E12.12c locus.

  • Co-transform with Cas9 expression plasmid and repair template.

  • Screen transformants for successful editing events.

These genetic tools enable comprehensive functional analysis of PB17E12.12c in its native cellular context.

What are the recommended controls for experiments involving PB17E12.12c in translational regulation studies?

When studying the potential role of PB17E12.12c in translational regulation, several controls are essential:

Positive controls:

  • Known translational regulators in S. pombe (e.g., eIF4E, eIF4G proteins) that show clear phenotypes when manipulated

  • mRNAs with established translational regulation patterns under stress conditions

Negative controls:

  • Housekeeping genes with stable translation efficiency across conditions

  • Mitochondrial proteins unrelated to translation

  • Cytosolic carriers with similar structure but different localization

Experimental controls:

  • Wild-type strains subjected to identical conditions

  • Time-course analyses to distinguish between primary and secondary effects

  • Translational efficiency measurements using polysome profiling alongside total mRNA quantification to differentiate translational from transcriptional effects

  • Parallel analysis of protein levels using Western blotting

For polysome profiling experiments in particular, compare the distribution of PB17E12.12c mRNA across non-polysomal, light polysomal, and heavy polysomal fractions under various stress conditions (heat shock, oxidative stress) as these have been shown to trigger significant translational reprogramming in S. pombe .

How can I determine if PB17E12.12c undergoes stress-induced translational regulation in S. pombe?

To investigate stress-induced translational regulation of PB17E12.12c, implement the following comprehensive approach:

Polysome profiling methodology:

  • Culture S. pombe cells to mid-log phase and expose to relevant stressors (heat shock at 42°C, oxidative stress with 0.5 mM H₂O₂, or nutrient limitation)

  • Harvest cells at multiple time points (5, 15, 30, 60 minutes) after stress induction

  • Treat with cycloheximide to freeze ribosomes on mRNAs

  • Prepare cell lysates and fractionate over 10-50% sucrose gradients

  • Collect fractions while monitoring absorbance at 254 nm

  • Extract RNA from individual fractions

  • Quantify PB17E12.12c mRNA in each fraction using RT-qPCR

Translational efficiency calculation:
Determine translational efficiency (TE) using the formula:
TE = (Signal in polysomal fractions) / (Signal in total mRNA)

Compare these values between stressed and unstressed conditions. Significant changes in TE without proportional changes in total mRNA levels would indicate translational regulation .

Ribosome profiling:
For higher resolution analysis, implement ribosome profiling:

  • Isolate ribosome-protected fragments (RPFs) from stressed and unstressed cells

  • Prepare libraries for deep sequencing

  • Calculate the translational efficiency as the ratio of RPFs to mRNA abundance

  • Analyze ribosome occupancy patterns across the PB17E12.12c coding sequence

This would reveal potential regulatory elements within the mRNA sequence and identify precise sites of translational control.

What approaches can be used to characterize the interactome of PB17E12.12c in mitochondrial membranes?

Characterizing the protein-protein interaction network of PB17E12.12c requires multiple complementary approaches:

Affinity purification-mass spectrometry (AP-MS):

  • Express epitope-tagged PB17E12.12c in S. pombe

  • Isolate mitochondria and solubilize membranes with mild detergents

  • Perform immunoprecipitation using antibodies against the tag

  • Analyze co-purifying proteins by mass spectrometry

  • Validate interactions using reciprocal pulldowns

Proximity-based labeling:

  • Fuse PB17E12.12c to a promiscuous biotin ligase (BioID) or peroxidase (APEX)

  • Express the fusion protein in S. pombe

  • Provide biotin substrate to label proteins in close proximity

  • Isolate biotinylated proteins using streptavidin affinity purification

  • Identify labeled proteins by mass spectrometry

Crosslinking mass spectrometry (XL-MS):

  • Treat isolated mitochondria with chemical crosslinkers

  • Digest proteins and enrich for crosslinked peptides

  • Analyze by mass spectrometry to identify interaction interfaces

Functional validation experiments:

  • Genetic interaction screens using synthetic genetic array (SGA) methodology

  • Co-fractionation studies during mitochondrial purification

  • In vitro reconstitution of key interactions in liposomes

ApproachAdvantagesLimitationsBest For
AP-MSHigh specificity, established protocolsMay lose weak/transient interactionsStable complex identification
Proximity labelingCaptures transient interactions, works in native contextPotential false positives from spatial proximityIn situ interaction mapping
XL-MSProvides structural information, captures direct contactsComplex data analysis, limited crosslinking distanceInteraction interface mapping

These approaches should be integrated to build a comprehensive interactome map for PB17E12.12c.

How can the functional significance of PB17E12.12c be assessed in relation to mitochondrial translation and OXPHOS complex assembly?

To evaluate the functional significance of PB17E12.12c in mitochondrial translation and OXPHOS complex assembly, implement this multifaceted research strategy:

Mitochondrial translation assessment:

  • Perform in organello translation assays using isolated mitochondria from wild-type and PB17E12.12c-deleted strains

  • Label newly synthesized mitochondrial proteins with 35S-methionine

  • Analyze protein synthesis rates by SDS-PAGE and autoradiography

  • Quantify translation efficiency for individual mitochondrially-encoded proteins

OXPHOS complex analysis:

  • Isolate mitochondria from wild-type and mutant strains

  • Analyze respiratory chain complexes by Blue Native PAGE

  • Measure complex assembly and stability through Western blotting

  • Perform in-gel activity assays for individual complexes

Functional respiratory measurements:

  • Assess oxygen consumption rates using high-resolution respirometry

  • Measure mitochondrial membrane potential using potentiometric dyes

  • Evaluate ATP production capacity in isolated mitochondria

  • Perform growth tests on fermentable vs. non-fermentable carbon sources

Metabolomic analysis:

  • Profile mitochondrial metabolites using LC-MS/MS

  • Quantify changes in TCA cycle intermediates

  • Analyze metabolic flux using 13C-labeled substrates

If PB17E12.12c functions as a mitochondrial carrier, substrate transport assays using reconstituted protein in liposomes would be crucial to identify its specific transport substrates and kinetic parameters. This would connect its molecular function to the observed cellular phenotypes.

What are the potential implications of studying PB17E12.12c for understanding human mitochondrial diseases?

The study of PB17E12.12c has significant implications for human mitochondrial disease research due to the conservation of mitochondrial expression systems between S. pombe and humans :

Translational relevance:

  • The machinery for mitochondrial gene expression is structurally and functionally conserved between fission yeast and humans

  • Mitochondrial carriers frequently have human orthologs with similar functions

  • Mutations in mitochondrial carrier proteins are implicated in numerous human diseases

Potential disease connections:
If PB17E12.12c is involved in mitochondrial translation or metabolite transport, its human ortholog could be relevant to conditions such as:

  • Combined oxidative phosphorylation deficiency disorders

  • Mitochondrial translation defects

  • Metabolic disorders affecting energy production

Research pathways:

  • Identify the human ortholog through sequence homology and functional complementation studies

  • Examine whether patient mutations in the orthologous gene affect similar pathways

  • Establish whether the pathogenesis of specific mitochondrial diseases involves disruption of the processes regulated by PB17E12.12c

  • Develop S. pombe as a model system to screen potential therapeutic compounds targeting these pathways

The petite-negative phenotype of S. pombe makes it particularly relevant for studying essential mitochondrial functions that cannot be easily investigated in budding yeast (S. cerevisiae), which can survive without functional mitochondria .

How can high-throughput approaches be implemented to study the role of PB17E12.12c in global translational response to stress?

High-throughput strategies to investigate PB17E12.12c's role in global translational responses include:

Integrative omics approach:

  • Ribosome profiling: Implement deep sequencing of ribosome-protected fragments in wild-type vs. PB17E12.12c mutant strains under various stress conditions. This provides genome-wide translational efficiency data at nucleotide resolution .

  • Polysome profiling coupled with RNA-seq: Sequence mRNAs associated with different polysome fractions to identify transcripts whose translation is differentially affected by PB17E12.12c deletion.

  • Proteomics time-course: Perform quantitative proteomics at multiple time points after stress induction to correlate translational and post-translational effects.

  • Bioinformatic integration: Develop computational pipelines to integrate these datasets and identify:

    • Transcripts whose translation is specifically affected by PB17E12.12c

    • Sequence features associated with PB17E12.12c-dependent regulation

    • Temporal dynamics of the translational response

CRISPR screening approach:

  • Generate a genome-wide CRISPR library in both wild-type and PB17E12.12c-mutant backgrounds

  • Subject cells to various stresses and identify genetic interactions

  • Identify pathways that become essential in the absence of PB17E12.12c

This multiomics approach would reveal not only the direct role of PB17E12.12c in translational regulation but also its position within the broader stress response network .

What cutting-edge methodologies could reveal the structural dynamics of PB17E12.12c during substrate transport?

Understanding the structural dynamics of PB17E12.12c during substrate transport requires state-of-the-art methodologies:

Cryo-electron microscopy (Cryo-EM):

  • Purify PB17E12.12c to high homogeneity in various functional states (substrate-free, substrate-bound, transport intermediate)

  • Perform single-particle cryo-EM analysis to determine structures at near-atomic resolution

  • Generate computational models of the transport cycle

Single-molecule FRET:

  • Introduce fluorescent probes at strategic positions within the protein

  • Monitor conformational changes during substrate binding and transport in real-time

  • Determine the kinetics and conformational states of the transport cycle

Molecular dynamics simulations:

  • Use experimental structures as starting points for simulations

  • Model membrane environment and substrate interactions

  • Simulate the complete transport process to identify key residues and conformational transitions

Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Monitor protein dynamics in different functional states

  • Identify regions with altered solvent accessibility during the transport cycle

  • Map conformational changes to functional domains

In silico substrate docking and transport pathway identification:

  • Perform computational docking of potential substrates

  • Identify substrate binding residues and transport pathway

  • Guide mutagenesis experiments to validate the mechanism

These approaches would provide unprecedented insights into the structural basis of substrate recognition, binding, and translocation by this mitochondrial carrier protein, potentially revealing conserved mechanisms applicable to the broader mitochondrial carrier family.

What are the common challenges in expressing and purifying recombinant PB17E12.12c, and how can they be addressed?

Membrane proteins like PB17E12.12c present specific challenges during recombinant expression and purification. Here are common issues and their solutions:

Low expression levels:

  • Challenge: Mitochondrial membrane proteins often express poorly in heterologous systems.

  • Solutions:

    • Test multiple expression systems (E. coli, yeast, insect cells)

    • Optimize codon usage for the expression host

    • Use specialized strains (e.g., C41/C43 for E. coli)

    • Employ fusion partners (MBP, SUMO) to enhance solubility

    • Implement inducible promoters with fine-tuned expression levels

Protein aggregation:

  • Challenge: Hydrophobic regions can cause aggregation during extraction.

  • Solutions:

    • Screen multiple detergents (DDM, LMNG, GDN) at various concentrations

    • Include stabilizing agents (glycerol, specific lipids) in purification buffers

    • Reduce extraction temperature to 4°C

    • Consider styrene-maleic acid (SMA) copolymers for native nanodiscs

Purification troubleshooting guide:

IssueIndicatorsSolutions
ProteolysisMultiple bands on SDS-PAGEAdd protease inhibitors, reduce purification time
Low binding to affinity resinPoor yield in elution fractionsOptimize tag position, adjust buffer conditions
Detergent-induced instabilityPrecipitation during concentrationScreen detergents, add stabilizing lipids
Oligomerization state variabilityMultiple peaks in size exclusionAdjust detergent:protein ratio, add specific lipids

Quality control checkpoints:

  • Test protein homogeneity by analytical size exclusion chromatography

  • Assess secondary structure integrity by circular dichroism

  • Verify functional activity through substrate binding or transport assays

  • Confirm correct folding through limited proteolysis experiments

These optimizations are critical for obtaining sufficient quantities of properly folded, functional protein for downstream structural and functional studies.

How can technical challenges in studying translational regulation of low-abundance transcripts like PB17E12.12c be overcome?

Studying translational regulation of low-abundance transcripts like PB17E12.12c presents significant technical challenges. Here are effective strategies to overcome these limitations:

Enhanced detection methods:

  • Targeted RNA-seq: Focus sequencing depth on specific genes of interest rather than global profiling

  • Transcript-specific amplification: Use targeted pre-amplification before polysome profiling

  • Single-molecule FISH: Visualize individual mRNA molecules and their association with ribosomes in situ

  • Nanopore direct RNA sequencing: Detect native transcripts without amplification bias

Enrichment strategies:

  • TRAP (Translating Ribosome Affinity Purification):

    • Express tagged ribosomal proteins in S. pombe

    • Immunoprecipitate ribosomes and associated mRNAs

    • Analyze PB17E12.12c mRNA enrichment in the ribosome-associated fraction

  • SUnSET method adaptation:

    • Pulse-label nascent proteins with puromycin

    • Immunoprecipitate PB17E12.12c protein

    • Quantify puromycin incorporation as a direct measure of translation

Sensitive quantification techniques:

  • Droplet digital PCR (ddPCR) for absolute quantification of low-abundance transcripts

  • Proximity ligation assay (PLA) to detect interactions between PB17E12.12c mRNA and translation factors

  • Enzyme-linked immunosorbent assay (ELISA) with amplification steps for protein quantification

Overcoming polysome profiling limitations:

  • Increase starting material (scale up culture volumes)

  • Optimize lysis conditions specifically for mitochondrial membrane-associated mRNAs

  • Include spike-in controls to normalize for technical variation

  • Employ ribo-depletion strategies to enrich for low-abundance transcripts

By implementing these advanced methodologies, researchers can overcome the technical challenges associated with studying translational regulation of low-abundance transcripts like PB17E12.12c that might play important roles in mitochondrial function .

What are the most promising research directions for understanding the function of PB17E12.12c in S. pombe and its relevance to human health?

The most promising research directions for PB17E12.12c involve integrating multiple approaches to determine its precise function and translational relevance:

Fundamental characterization priorities:

  • Substrate identification through transport assays, metabolomics, and computational modeling

  • High-resolution structural determination to understand transport mechanisms

  • Comprehensive interactome mapping to place it within the mitochondrial functional network

  • Investigation of regulatory mechanisms controlling its expression and activity during stress conditions

Translational research opportunities:

  • Identification and characterization of human orthologs through phylogenetic analysis

  • Development of S. pombe disease models incorporating human patient mutations

  • Investigation of PB17E12.12c's role in maintaining mitochondrial translation fidelity, which may have implications for mitochondrial diseases

  • Exploration of potential stress-protective functions that might be exploited therapeutically

Emerging technical approaches:

  • Implementation of spatial transcriptomics to understand the subcellular localization of PB17E12.12c mRNA translation

  • Development of mitochondria-specific translation reporter systems

  • Application of AlphaFold and related AI tools to model structural interactions

  • Integration of multi-omics data through systems biology approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.