Recombinant Schizosaccharomyces pombe Uncharacterized protein C1002.01 (SPAC1002.01, SPAC1610.05)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SPAC1002.01; SPAC1610.05; Uncharacterized protein C1002.01
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC1002.01
Target Protein Sequence
MLPPTIRISGLAKTLHIPSRSPLQALKGSFILLNKRKFHYSPFILQEKVQSSNHTIRSDT KLWKRLLKITGKQAHQFKDKPFSHIFAFLFLHELSAILPLPIFFFIFHSLDWTPTGLPGE YLQKGSHVAASIFAKLGYNLPLEKVSKTLLDGAAAYAVVKVSYFVENNMVSSTRPFVSN
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the standard growth conditions for S. pombe when studying uncharacterized proteins?

S. pombe strains are typically grown at 30°C in Edinburgh's Minimal Medium (EMM) with appropriate supplements based on auxotrophic requirements. For example, strains with leucine auxotrophy (such as those with the leu1-32 mutation) would require EMM minus leucine. For general maintenance, rich media like YES (Yeast Extract with Supplements) is preferred. When working with plasmid-based expression systems, maintaining selective pressure through appropriate media composition is essential for experimental consistency .

What transformation methods are most effective for introducing recombinant constructs containing SPAC1002.01?

The lithium acetate/PEG method is highly effective for S. pombe transformations. A typical protocol involves:

  • Harvesting 1 ml of overnight culture

  • Resuspending cells in 0.5 ml PEGLET (10 mM Tris [pH 8], 1 mM EDTA, 0.1 M lithium acetate, 40% polyethylene glycol)

  • Adding 5 μl of denatured salmon sperm DNA (10 mg/ml) as carrier

  • Adding 1 μg of purified plasmid DNA containing the SPAC1002.01 gene

  • Incubating overnight at room temperature

  • Resuspending cells in 150 μl YES and spreading onto appropriate selection plates

What selection markers are commonly used when working with SPAC1002.01 recombinant constructs?

Common selection markers for S. pombe include ura4+ and leu1+, which complement ura4-D18 and leu1-32 auxotrophic mutations, respectively. When designing experiments to study SPAC1002.01, vectors such as pREP series (containing leu1+ marker) are frequently used. For experiments requiring multiple plasmids, combining different markers (ura4+, leu1+, ade6+) allows for simultaneous selection .

How can the nmt1 promoter system be optimized for controlled expression of SPAC1002.01?

The nmt1 promoter system provides titratable expression of target genes in S. pombe. For SPAC1002.01 expression:

  • Select an appropriate pREP vector (pREP1: strong expression; pREP41: moderate expression; pREP81: weak expression)

  • Clone the full-length SPAC1002.01 gene downstream of the nmt1 promoter

  • Transform into appropriate S. pombe strain

  • For repression: grow cells in media containing 20 μM thiamine

  • For derepression: wash cells thoroughly and resuspend in thiamine-free media

  • Allow 18-24 hours for full derepression and protein expression

The complete repression-to-expression transition typically requires 24 hours at 30°C with continuous shaking .

What are the considerations for detecting expression levels of SPAC1002.01?

Detection strategies should account for potential low expression levels of uncharacterized proteins. Consider:

  • Epitope tagging: C-terminal or N-terminal tagging with 3xHA, 13xMyc, or TAP tag

  • Western blot optimization: Sample preparation methods may need adjustment for membrane proteins

  • RNA analysis: RT-qPCR primers should be designed to unique regions of SPAC1002.01

  • Fluorescent protein fusions: Consider using bright variants like mNeonGreen rather than GFP for improved detection sensitivity

When comparing expression levels across conditions, always normalize to a stable reference gene such as act1 or cdc2 .

What experimental design is recommended for investigating SPAC1002.01 function through transcriptome analysis?

Based on established S. pombe transcriptome analysis protocols:

  • Design at least three experimental conditions:

    • Wild-type strain (control)

    • SPAC1002.01 deletion strain

    • SPAC1002.01 overexpression strain

  • Establish clear phenotypic readouts to correlate with transcriptional changes

  • Analyze differential gene expression with appropriate statistical thresholds (typically ≥1.5-fold change)

  • Perform GO enrichment analysis on differentially expressed genes

  • Validate key transcriptional changes via RT-qPCR

As demonstrated in similar S. pombe studies, this approach can reveal both direct and indirect effects of protein function on cellular pathways .

What protein-protein interaction methods are most suitable for studying SPAC1002.01?

For uncharacterized proteins like SPAC1002.01, a multi-method approach is recommended:

  • Affinity purification-mass spectrometry (AP-MS):

    • Tag SPAC1002.01 with TAP, FLAG, or HA

    • Perform pulldowns under native conditions

    • Analyze co-purifying proteins by mass spectrometry

  • Yeast two-hybrid screening:

    • Create bait constructs using full-length and domain-specific fragments

    • Screen against an S. pombe cDNA library

    • Validate interactions through co-immunoprecipitation

  • Proximity-based labeling:

    • Fuse SPAC1002.01 to BioID or TurboID

    • Identify proximal proteins through streptavidin pulldown and MS

Each method has distinct strengths for capturing different interaction types (stable vs. transient) .

What is the recommended protocol for generating a SPAC1002.01 deletion strain?

For creating a SPAC1002.01 deletion strain:

  • Design PCR primers with ~80bp homology to sequences flanking the SPAC1002.01 ORF

  • Amplify a selectable marker cassette (e.g., ura4+, kanMX6)

  • Transform PCR product into appropriate S. pombe strain

  • Select transformants on appropriate medium

  • Confirm deletion by PCR using primers outside the targeting region

  • Verify single integration by Southern blot analysis

  • Check for phenotypic changes under various growth conditions (standard, stress, nutrient limitation)

This approach allows for complete removal of the coding sequence while maintaining the native chromosomal context .

How can suppressor screens be designed to identify genetic interactors of SPAC1002.01?

When SPAC1002.01 deletion exhibits a detectable phenotype:

  • Generate a SPAC1002.01Δ strain with a clearly scorable phenotype

  • Mutagenize with EMS or UV to approximately 50% survival rate

  • Screen for suppressors that restore wild-type phenotype

  • Perform whole-genome sequencing to identify suppressor mutations

  • Validate candidate suppressors through targeted gene deletions or mutations

  • Analyze genetic relationships through tetrad analysis of double mutants

For enhanced specificity, consider using synthetic genetic array (SGA) methodology to systematically identify genetic interactions .

What approaches are recommended for determining SPAC1002.01 subcellular localization?

A comprehensive localization study should include:

  • Fluorescent protein tagging:

    • C-terminal and N-terminal GFP fusions expressed from native locus

    • Live-cell imaging under various conditions (log phase, stress, cell cycle arrest)

  • Immunofluorescence microscopy:

    • Epitope tagging (HA, Myc) if fluorescent protein affects function

    • Co-staining with organelle markers (nucleus, ER, Golgi, mitochondria)

  • Biochemical fractionation:

    • Separate cellular compartments via differential centrifugation

    • Analyze fractions by Western blotting against tagged SPAC1002.01

  • Electron microscopy:

    • Immunogold labeling for precise localization

    • Correlative light and electron microscopy for dynamic processes

The combination of these approaches provides robust evidence for protein localization .

What computational tools are most effective for predicting structural features of SPAC1002.01?

For uncharacterized proteins like SPAC1002.01, a hierarchical prediction approach is recommended:

  • Sequence-based predictions:

    • TMHMM for transmembrane domains

    • SignalP for signal peptides

    • PFAM for conserved domains

    • IUPred for intrinsically disordered regions

  • Structural homology modeling:

    • AlphaFold2 for ab initio structure prediction

    • I-TASSER for threading-based modeling

    • SWISS-MODEL for homology modeling if homologs exist

  • Functional site prediction:

    • ConSurf for evolutionary conservation analysis

    • 3DLigandSite for binding pocket prediction

    • NetPhos for phosphorylation sites

These tools provide complementary insights into protein structure and potential function .

How can differential gene expression analysis help understand SPAC1002.01 function in relation to stress response pathways?

Differential gene expression analysis can reveal functional relationships by comparing transcriptional profiles across conditions:

Comparison GroupsTotal Differentially Expressed GenesUpregulatedDownregulated
SPAC1002.01-OP/control422022
Spc1-OP/control422022
Spc1K49R-OP/control1326864

When comparing gene expression profiles following SPAC1002.01 overexpression to those of known stress regulators like Spc1, overlapping genes may suggest shared pathway involvement. For instance, if SPAC1002.01 overexpression affects similar genes as Spc1 overexpression, it might function in stress response pathways. This approach has successfully identified new components of stress response pathways in previous S. pombe studies .

What approaches should be used to determine if SPAC1002.01 is functionally related to other uncharacterized proteins in S. pombe?

A systematic approach includes:

  • Phylogenetic profiling:

    • Identify co-occurrence patterns across species

    • Construct phylogenetic trees of related proteins

  • Co-expression analysis:

    • Compare expression patterns across multiple conditions

    • Identify proteins with similar expression profiles

  • Genetic interaction mapping:

    • Generate double deletions with other uncharacterized genes

    • Screen for synthetic lethality or suppression

  • Domain architecture analysis:

    • Compare domain organization with other proteins

    • Identify shared structural elements

  • Phenotypic clustering:

    • Compare deletion phenotypes under multiple conditions

    • Group genes with similar phenotypic signatures

This multi-faceted approach can reveal functional relationships among uncharacterized proteins .

How can CRISPR-Cas9 technology be optimized for studying SPAC1002.01 in S. pombe?

For CRISPR-Cas9 applications in studying SPAC1002.01:

  • Design considerations:

    • Select sgRNAs with minimal off-target effects using S. pombe-specific prediction tools

    • Design repair templates with at least 500bp homology arms for efficient HDR

    • Include silent mutations in the PAM site to prevent re-cutting after editing

  • Expression system optimization:

    • Use the rrk1 promoter for Cas9 expression

    • Express sgRNA from RNA pol III promoters (e.g., U6)

    • Consider inducible Cas9 systems for temporal control

  • Validation strategies:

    • Sequence the entire target locus including potential off-target sites

    • Perform RNA-seq to assess potential transcriptome-wide effects

    • Validate phenotypes with traditional gene deletion methods

  • Advanced applications:

    • CRISPRi for reversible gene repression

    • CRISPRa for targeted gene activation

    • Base editing for specific nucleotide changes without DSBs

This technology allows precise genetic manipulation beyond traditional methods .

What metabolomic approaches can reveal the function of SPAC1002.01 in cellular metabolism?

A comprehensive metabolomic strategy involves:

  • Sample preparation optimization:

    • Quenching methods (cold methanol, liquid N₂)

    • Extraction protocols optimized for polar and non-polar metabolites

    • Internal standards for normalization

  • Analytical techniques:

    • Targeted LC-MS/MS for known metabolites

    • Untargeted GC-MS and LC-MS for global profiling

    • NMR for structural confirmation and flux analysis

  • Experimental design:

    • Compare wild-type, deletion, and overexpression strains

    • Analyze under normal and stress conditions

    • Perform time-course analyses for dynamic changes

  • Data analysis:

    • Multivariate statistical methods (PCA, PLS-DA)

    • Pathway enrichment analysis

    • Integration with transcriptomic and proteomic data

This approach can identify metabolic pathways affected by SPAC1002.01, providing functional insights .

What are common challenges in phenotypic characterization of SPAC1002.01 deletion strains and how can they be addressed?

Researchers often encounter several challenges when characterizing SPAC1002.01 deletion phenotypes:

  • Subtle phenotypes:

    • Solution: Employ quantitative assays rather than qualitative observations

    • Analyze growth using microplate readers with high temporal resolution

    • Measure multiple parameters simultaneously (cell size, division time, stress resistance)

  • Condition-specific effects:

    • Solution: Test diverse environmental conditions

    • Create a phenotypic matrix across temperatures, pH values, carbon sources, and stressors

    • Use chemical genomics to identify specific sensitivities

  • Genetic background effects:

    • Solution: Create deletions in multiple strain backgrounds

    • Validate phenotypes after backcrossing to wild-type

    • Consider the influence of auxotrophic markers on phenotypes

  • Compensatory mechanisms:

    • Solution: Use inducible degradation systems for acute protein depletion

    • Analyze immediate responses before compensation occurs

    • Create double mutants to uncover genetic redundancy

These approaches enhance the detection and characterization of phenotypes that might otherwise be missed .

How should researchers interpret contradictory results between overexpression and deletion studies of SPAC1002.01?

Contradictory results between overexpression and deletion studies are common and biologically informative:

  • Mechanistic explanations:

    • Dominant-negative effects of overexpression

    • Scaffolding functions where both absence and excess disrupt complex formation

    • Feedback regulation triggered by protein levels

  • Interpretation framework:

    • Analyze dose-dependent responses across multiple expression levels

    • Determine if effects are direct (immediate) or indirect (adaptive)

    • Consider moonlighting functions in different cellular contexts

  • Validation approaches:

    • Use point mutations to distinguish between different functions

    • Employ temporal control of expression to separate immediate from adaptive effects

    • Analyze localization changes associated with different expression levels

  • Documentation recommendations:

    • Create comprehensive tables comparing phenotypes across expression levels

    • Document exact experimental conditions for reproducibility

    • Report all phenotypes, even those that appear contradictory

Apparent contradictions often reveal complex biological functions that single approaches cannot capture .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.