Recombinant Schizosaccharomyces pombe Uncharacterized protein C1002.20 (SPAC1002.20)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

The protein is commercially available as a recombinant product for research use:

ParameterDetails
Expression SystemEscherichia coli or yeast systems .
TagDetermined during production (commonly His-tag) .
Purity>90% (SDS-PAGE verified) .
StorageTris-based buffer with 50% glycerol; store at -20°C/-80°C .
ApplicationsELISA, structural studies, antibody production .

Functional Hypotheses

While SPAC1002.20 remains uncharacterized, adjacent genes and genomic context provide clues:

  • Co-Localization: Proximity to urg1/2/3 genes implies possible involvement in stress responses or nucleotide metabolism .

  • Cell Wall Dynamics: Proteins in nearby loci (e.g., pom1) regulate cell polarity, suggesting SPAC1002.20 might contribute to membrane or cytoskeletal functions .

Research Gaps and Future Directions

  • Functional Validation: No knockout or overexpression studies reported to date.

  • Interaction Mapping: Potential binding partners (e.g., membrane proteins or kinases) remain unexplored.

  • Structural Biology: Cryo-EM or crystallography could resolve its conformation .

References

- ELISA Recombinant SPAC1002.20 product sheet.
- GEO Accession GPL10187: S. pombe microarray annotations.
- PLOS ONE study on uracil-regulatable promoters in S. pombe.
- Biozoomer custom recombinant protein services.

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand your specific needs. If you require a particular format, kindly specify it during order placement. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for detailed delivery timelines.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your specific requirements.
Shelf Life
The shelf life of our products can be influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. To ensure optimal quality, aliquotation is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during our production process. If you have a specific tag type in mind, please inform us, and we will prioritize fulfilling your request.
Synonyms
SPAC1002.20; Uncharacterized protein C1002.20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC1002.20
Target Protein Sequence
MTFQRSLRDGFHRLINFYFYPSYHDTVVHNLAFSTSDYIYFKHLTDRNDDALLKVDQTIN KTNRFIFRKLKILCPSFLNYSFINIYCFGPYTMVGEEFLFF
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the initial steps for characterizing the uncharacterized protein SPAC1002.20 in S. pombe?

To begin characterizing SPAC1002.20, implement an endogenous tagging strategy similar to that used in comprehensive TF studies. Start by creating a strain with the protein tagged with a uniform epitope tag (e.g., FLAG-tag or HA-tag) at its endogenous locus to maintain physiological expression levels. This approach was successfully employed to create a library of 89 endogenously tagged transcription factors in S. pombe, preserving their natural regulatory contexts .

Following strain generation, confirm expression using Western blot analysis and proceed with preliminary localization studies using fluorescence microscopy. RNA expression profiling through mRNA-seq can provide insights into expression patterns under different growth conditions, similar to the vegetative growth expression analysis performed for the TF library that revealed distinct expression patterns across factors .

How can I determine if SPAC1002.20 is expressed in standard laboratory growth conditions?

Implement mRNA expression profiling (mRNA-seq) similar to that used for TF characterization in S. pombe. Research has shown that some S. pombe proteins have condition-specific expression patterns, with certain transcription factors like Mei4, Atf31, and Atf21 showing upregulation specifically during meiosis while remaining undetectable during vegetative growth .

For standardized growth conditions, culture S. pombe cells in YES medium (yeast extract with supplements) at 30°C with appropriate aeration until mid-log phase (OD600 of 0.5-0.8). Extract total RNA using established protocols with DNase treatment to eliminate genomic DNA contamination. Perform RT-qPCR using carefully selected reference genes for normalization (see table below for recommended reference genes) and/or RNA-seq analysis to quantify expression levels .

Reference GeneStability ValueRecommended Use Case
Act1 (actin)HighGeneral conditions
Tef1HighGrowth phase studies
Cdc2MediumCell cycle studies
SPAC1002.20*UnknownTarget gene

*Expression pattern needs to be determined experimentally

What genetic approaches can confirm the function of SPAC1002.20?

Employ a multi-faceted genetic approach combining deletion/knockout, complementation, and overexpression studies. First, create a deletion strain using homologous recombination, replacing SPAC1002.20 with a selectable marker. Assess phenotypic consequences across various growth conditions, including standard media, nutrient limitation, temperature stress, and oxidative stress.

For complementation studies, reintroduce the wild-type gene using plasmid-based or integrative approaches to confirm phenotype restoration. Additionally, create point mutations in predicted functional domains to assess structure-function relationships. Overexpression using the nmt1 promoter system (with varying strengths - full, medium, or low) can reveal gain-of-function phenotypes or toxicity effects.

Combine these genetic approaches with transcriptome analysis to identify genes affected by SPAC1002.20 manipulation, potentially revealing functional pathways and regulatory networks .

How can I identify potential protein interaction partners of SPAC1002.20?

Implement a dual-stringency immunoprecipitation-mass spectrometry (IP-MS) approach as demonstrated in comprehensive TF interactome studies. First, perform low-stringency (150 mM NaCl) IP-MS screening to capture a wide range of potential interactors. Follow this with high-stringency (500 mM NaCl) validation to confirm stable interactions and eliminate false positives .

For the immunoprecipitation procedure:

  • Harvest 100-200 ml of cells (OD600 of 0.8) from the endogenously tagged strain

  • Lyse cells using glass bead disruption in lysis buffer containing protease inhibitors

  • Clear lysates by centrifugation at 13,000g for 20 minutes

  • Incubate with antibody-conjugated magnetic beads for 2-3 hours at 4°C

  • Wash extensively with buffers of appropriate stringency

  • Elute and process samples for mass spectrometry analysis

This approach identified protein interactors for approximately half of the investigated TFs in S. pombe, with over 25% forming stable complexes that persisted even under high-stringency conditions .

What approaches can determine if SPAC1002.20 interacts with chromatin or specific genomic regions?

Chromatin immunoprecipitation followed by high-throughput sequencing (ChIP-seq) is the optimal approach for identifying potential DNA-binding sites. Using the endogenously tagged strain, perform ChIP-seq following these key steps:

  • Cross-link protein-DNA interactions with 1% formaldehyde for 15 minutes

  • Isolate and fragment chromatin to 200-500 bp fragments

  • Immunoprecipitate using antibodies against the epitope tag

  • Reverse cross-links and purify DNA

  • Prepare sequencing libraries and perform high-throughput sequencing

  • Analyze data using peak-calling algorithms to identify enriched genomic regions

Important considerations include control for non-specific binding by comparing to input DNA and including appropriate negative controls. This approach successfully identified DNA binding sites for most transcription factors across 2,027 unique genomic regions in S. pombe, revealing novel binding motifs and regulatory networks .

For proteins without direct DNA-binding activity, ChIP-seq can still reveal chromatin association through interactions with other DNA-binding proteins or chromatin-associated complexes.

How can I determine if SPAC1002.20 forms a stable complex or heterodimer with other proteins?

Implement a multi-angle approach combining size-exclusion chromatography with IP-MS and cross-linking technologies. Recent research in S. pombe identified stable protein complexes, including a novel repressive heterodimer (Ntu1/Ntu2) linked to perinuclear gene localization .

Methodological steps include:

  • Perform gel filtration chromatography on native protein extracts to determine approximate complex size

  • Use tandem affinity purification (TAP) by tagging SPAC1002.20 and potential partner proteins

  • Implement two-step purification to isolate intact complexes

  • Analyze complex composition by mass spectrometry

  • Validate interactions using reciprocal co-IP experiments

  • Apply in vivo proximity labeling (BioID or TurboID) to capture transient or weak interactions

For detailed structural analysis of stable complexes, consider cross-linking mass spectrometry (XL-MS) to map interaction interfaces, potentially revealing functional domains critical for complex formation .

What statistical approaches should I use to analyze ChIP-seq data for SPAC1002.20?

Implement a comprehensive statistical workflow to distinguish genuine binding events from artifacts. Begin with quality control of sequencing data using FastQC to assess read quality, followed by alignment to the S. pombe reference genome using Bowtie2 or BWA.

For peak calling, use MACS2 with a q-value threshold of 0.01 and a fold-enrichment filter of ≥2. Importantly, S. pombe research has identified "high occupancy target" (HOT) regions bound by multiple transcription factors, which require careful interpretation . The analysis should differentiate between:

  • Specific binding sites (unique to SPAC1002.20)

  • HOT regions (bound by multiple factors)

  • Technical artifacts (false positives)

To identify genuine binding motifs, perform de novo motif discovery using MEME, HOMER, or similar tools on sequences from peak regions. Cross-reference identified motifs with known motif databases and validate novel motifs experimentally using electrophoretic mobility shift assays (EMSA) or reporter gene assays .

How should I integrate RNA-seq and ChIP-seq data to determine the regulatory role of SPAC1002.20?

Implement an integrated analysis approach that combines binding data with expression profiling to construct a regulatory network model. The methodological workflow should include:

  • Generate RNA-seq data from both wild-type and SPAC1002.20 deletion/overexpression strains

  • Identify differentially expressed genes (DEGs) using DESeq2 or edgeR with adjusted p-value <0.05

  • Correlate ChIP-seq binding sites with proximal genes to identify direct targets

  • Classify targets based on expression changes (activated vs. repressed)

  • Perform Gene Ontology (GO) enrichment analysis to identify regulated biological processes

Recent S. pombe research revealed extensive cross- and autoregulation among transcription factors, with 43 TF promoters bound by at least one other TF . Similar analyses can determine if SPAC1002.20 participates in such regulatory networks, potentially revealing its function in specific cellular pathways.

What approaches can help determine if SPAC1002.20 is associated with specific subnuclear compartments?

Implement a multi-modal imaging approach combined with biochemical fractionation to characterize subnuclear localization. Recent research in S. pombe identified a repressive heterodimer linked to perinuclear gene localization, demonstrating the importance of spatial organization in gene regulation .

Methodological steps include:

  • Perform high-resolution confocal microscopy with the endogenously tagged SPAC1002.20 strain

  • Implement structured illumination microscopy (SIM) for super-resolution imaging

  • Use fluorescence recovery after photobleaching (FRAP) to assess protein dynamics

  • Combine with chromatin fractionation to biochemically validate associations

  • For specific compartment association, co-localize with known markers (nucleolus, nuclear envelope, heterochromatin)

For advanced spatial genomics, implement DNA fluorescence in situ hybridization (FISH) to correlate SPAC1002.20 localization with target gene positioning, potentially revealing roles in spatial genome organization similar to the Nattou complex in S. pombe .

How can CRISPR-Cas9 technology be applied to study SPAC1002.20 function in S. pombe?

Implement CRISPR-Cas9 genome editing for precise manipulation of SPAC1002.20. While traditional homologous recombination has been the standard for S. pombe genetic manipulation, CRISPR-Cas9 offers increased efficiency and versatility for complex genomic modifications.

The methodological approach includes:

  • Design sgRNAs targeting specific regions of SPAC1002.20 using established S. pombe CRISPR tools

  • Create a plasmid expressing Cas9 and the sgRNA under appropriate promoters

  • Include a repair template with desired modifications flanked by homology arms

  • Transform S. pombe cells and select for positive transformants

  • Verify edits by sequencing and expression analysis

This approach enables precise point mutations, domain deletions, or fusion protein creation without introducing selection markers, preserving the native genomic context. For studying proteins of unknown function, consider creating an AID (auxin-inducible degron) fusion for conditional protein depletion or a CRISPRi system for tunable repression .

How do I determine if post-translational modifications regulate SPAC1002.20 activity?

Implement a comprehensive PTM mapping strategy combining proteomic and genetic approaches. S. pombe research has revealed abundant interactions between transcription factors and regulatory phospho-binding 14-3-3 proteins, suggesting a conserved PTM-based regulatory mechanism .

The experimental workflow should include:

  • Purify the tagged protein under different growth conditions and stresses

  • Perform mass spectrometry analysis optimized for PTM detection:

    • Phosphorylation (TiO2 enrichment)

    • Ubiquitination (K-ε-GG antibody enrichment)

    • SUMOylation (specialized protocols)

  • Create non-modifiable mutants (e.g., S→A for phosphosites) to assess functional impact

  • Implement targeted approaches to identify modifying enzymes:

    • Kinase inhibitors/deletion strains for phosphorylation

    • Deubiquitinase inhibitors for ubiquitination

ConditionPhosphorylationUbiquitinationSUMOylation
Vegetative growthTo be determinedTo be determinedTo be determined
Stress responseTo be determinedTo be determinedTo be determined
MeiosisTo be determinedTo be determinedTo be determined

These approaches will reveal condition-specific regulatory mechanisms controlling SPAC1002.20 function .

What strategies can help identify genetic interactions of SPAC1002.20 within the S. pombe genome?

Implement systematic genetic interaction mapping through both targeted and genome-wide approaches. The methodological workflow should include:

  • Targeted double-mutant analysis with genes in related pathways:

    • Cross SPAC1002.20Δ with candidate interactor deletions

    • Assess synthetic phenotypes (lethality, growth defects, stress sensitivity)

    • Quantify interaction strength using colony size/growth rate measurements

  • For genome-wide interaction mapping, implement Synthetic Genetic Array (SGA) analysis:

    • Cross SPAC1002.20Δ with a deletion library (~3,400 non-essential S. pombe genes)

    • Select double mutants through sequential marker selection

    • Score growth phenotypes to identify synthetic interactions

    • Calculate genetic interaction scores to distinguish between aggravating and alleviating interactions

  • For essential genes, use temperature-sensitive or repressible alleles to assess interactions

This approach will position SPAC1002.20 within functional genetic networks, potentially revealing its biological role through the principle of guilt by association .

What controls are essential for validating SPAC1002.20 antibody specificity in immunoprecipitation experiments?

Implement a systematic validation approach incorporating multiple controls to ensure antibody specificity. For tagged proteins, this includes:

  • Parallel immunoprecipitation from untagged wild-type strains as negative controls

  • Western blot verification using both tag antibodies and, if available, protein-specific antibodies

  • Mass spectrometry confirmation of the immunoprecipitated protein

  • Competitive elution with tag peptides to confirm specific binding

  • Validation across different buffer conditions (salt concentrations, detergents)

For IP-MS experiments, implement stringent filtering criteria similar to those used in comprehensive S. pombe TF studies, including:

  • Enrichment relative to negative controls (≥3-fold)

  • Consistency across biological replicates (present in ≥2/3 replicates)

  • Statistical significance of enrichment (p<0.05)

  • Validation in high-stringency conditions for stable interactors

These controls and filtering criteria minimize false positives and ensure reliability of interaction data .

How can I address low expression issues when studying SPAC1002.20?

Implement a strategic approach to address low expression challenges, which are common for regulatory proteins in S. pombe. The comprehensive TF study demonstrated that factors with very low or undetectable expression levels showed poor enrichment in immunoprecipitation experiments .

Methodological solutions include:

  • Optimize growth conditions based on transcriptome data to identify when SPAC1002.20 is most highly expressed

  • Consider specialized induction conditions if SPAC1002.20 is stress-responsive

  • Implement tandem affinity purification (TAP) to increase enrichment efficiency

  • Use highly sensitive mass spectrometry approaches (Parallel Reaction Monitoring or Selected Reaction Monitoring)

  • For ChIP applications, increase sample input and optimize cross-linking conditions

  • Consider targeted approaches like CUT&RUN as alternatives to traditional ChIP-seq

For proteins with extremely low expression, consider creating an additional copy with an inducible promoter while maintaining the endogenous copy to study overexpression effects without losing natural regulation .

What is the optimal normalization strategy for RT-qPCR when studying SPAC1002.20 expression?

Implement a robust reference gene evaluation strategy similar to approaches used in fungal gene expression studies. The optimal normalization strategy requires:

  • Evaluation of multiple candidate reference genes (typically 5-8) across all experimental conditions

  • Assessment of expression stability using specialized algorithms:

    • BestKeeper for analyzing raw Cq values and calculating standard deviations

    • NormFinder for estimating both intra- and intergroup variation

    • geNorm for determining the minimum number of reference genes required

  • Selection of a reference gene combination that shows:

    • Low variation across all conditions (SD < 0.5 cycles)

    • No response to experimental treatments

    • Similar expression range to the target gene

Studies with fungal species identified actin (act1), β-tubulin, translation elongation factor (tef1), and glyceraldehyde-3-phosphate dehydrogenase (gpd) as potentially stable reference genes, but their stability must be experimentally verified for each specific condition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.