Recombinant Schizosaccharomyces pombe Uncharacterized protein C119.09c (SPBC119.09c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SPBC119.09c; Uncharacterized protein C119.09c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC119.09c
Target Protein Sequence
MGSSSSRRRSSSLVTKVPKPTIDDRLDQGSATNYNSNWVNYKGAWVIHIVLIAALRLIFH AIPSVSRELAWTLTNLTYMAGSFIMFHWVTGTPFEFNGGAYDRLTMWEQLDEGNQYTPAR KYLLVLPIILFLMSTHYTHYNGWMFLVNIWALFMVLIPKLPAVHRKRIFGIQKLSLRDDD NDSIPR
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What approaches can be used to determine the function of SPBC119.09c?

To determine the function of this uncharacterized protein, researchers should employ multiple complementary approaches:

  • Comparative genomics: Identify orthologs in related species and leverage known functional annotations.

  • Gene knockout/knockdown studies: Generate SPBC119.09c deletion strains and analyze resulting phenotypes across multiple conditions.

  • Protein localization: Use GFP-tagging to determine subcellular localization patterns.

  • Transcriptomics: Analyze expression patterns under different conditions, particularly during pheromone response and sexual differentiation pathways (based on insights from other S. pombe genes).

  • Interactome analysis: Perform co-immunoprecipitation or yeast two-hybrid screens to identify binding partners.

  • Structural prediction: Utilize advanced bioinformatics tools to predict domains and potential functions.

Similar strategies have been successfully applied to other uncharacterized S. pombe proteins such as SPBC4.01, which was found to be involved in sexual differentiation after initially being identified as a pheromone-responsive gene.

How is expression of SPBC119.09c regulated in wild-type S. pombe?

While specific regulation of SPBC119.09c is not fully characterized, research on similar uncharacterized S. pombe proteins suggests several regulatory patterns:

  • Nitrogen response: Many S. pombe genes involved in cellular differentiation respond to nitrogen starvation. Based on studies of similar proteins, SPBC119.09c may show increased expression under nitrogen limitation.

  • Pheromone response: By analogy with other S. pombe proteins like SPBC4.01, SPBC119.09c may be regulated by pheromone signaling pathways.

  • Cell cycle control: Expression may fluctuate throughout the cell cycle, particularly during transitions between mitotic growth and sexual differentiation.

To determine the specific regulation pattern, researchers should perform time-course experiments with quantitative PCR under various conditions, particularly nitrogen starvation and pheromone exposure, similar to approaches used for other uncharacterized S. pombe proteins.

What expression systems are optimal for recombinant SPBC119.09c production?

Based on established protocols, the following expression systems are recommended:

  • E. coli-based expression: The protein has been successfully expressed in E. coli with an N-terminal His-tag. This approach provides high yields suitable for biochemical characterization, as demonstrated by commercial preparations.

  • S. pombe expression: For studies requiring native post-translational modifications, expression in the original host organism using an inducible promoter system is recommended.

  • Baculovirus-insect cell system: For higher eukaryotic expression with proper protein folding, particularly if the protein has complex structural elements.

Expression SystemAdvantagesDisadvantagesRecommended Use Cases
E. coliHigh yield, cost-effective, rapidMay lack proper folding for complex proteinsInitial biochemical studies, structural analysis
S. pombeNative environment, proper foldingLower yield, more complexFunctional studies, interaction analysis
BaculovirusEukaryotic modifications, good foldingExpensive, time-consumingAdvanced structural studies

What purification strategies yield the highest purity and activity for SPBC119.09c?

A multi-step purification strategy is recommended:

  • Immobilized metal affinity chromatography (IMAC): For His-tagged SPBC119.09c, use Ni-NTA or Co-based resins with imidazole gradient elution.

  • Size exclusion chromatography: To separate aggregates and obtain homogeneous protein.

  • Ion exchange chromatography: As a polishing step to remove remaining contaminants.

For membrane-associated proteins like SPBC119.09c, include these considerations:

  • Use mild detergents during extraction and purification

  • Consider amphipols or nanodiscs for maintaining native structure

  • Optimize buffer conditions to prevent aggregation

Protocols have demonstrated that recombinant SPBC119.09c can be purified to >90% purity using such approaches.

How should recombinant SPBC119.09c be stored to maintain stability?

Optimal storage conditions for SPBC119.09c:

  • Store lyophilized powder at -20°C to -80°C

  • After reconstitution, add 5-50% glycerol (with 50% being optimal)

  • Aliquot to avoid repeated freeze-thaw cycles

  • For short-term use, store working aliquots at 4°C for up to one week

  • Use Tris/PBS-based buffer at pH 8.0 with 6% trehalose for stabilization

Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Brief centrifugation prior to opening is recommended to bring contents to the bottom of the vial.

How can protein-protein interactions of SPBC119.09c be investigated?

To identify interaction partners of SPBC119.09c, employ these complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS): Use tagged SPBC119.09c as bait to capture interacting proteins.

  • Yeast two-hybrid (Y2H) screening: Particularly useful for detecting binary interactions.

  • Proximity-dependent biotin identification (BioID): Identifies proteins in close proximity in living cells.

  • Förster resonance energy transfer (FRET): For measuring direct interactions in live cells.

  • Co-immunoprecipitation (Co-IP): For validation of specific interactions.

Experimental design considerations:

  • Use both N- and C-terminal tags to minimize interference with binding sites

  • Include membrane-compatible detergents when working with SPBC119.09c

  • Compare interactomes under different cellular conditions (e.g., nitrogen starvation, pheromone exposure)

  • Use quantitative approaches like SILAC to distinguish specific from non-specific interactions

What phenotypic assays can reveal SPBC119.09c function?

Based on research with similar S. pombe proteins, several phenotypic assays may provide insights:

  • Growth assays under stress conditions: Test SPBC119.09c knockout strains for sensitivity to temperature, osmotic stress, cell wall/membrane stressors, and DNA damage.

  • Mating and sporulation efficiency: By analogy with SPBC4.01, SPBC119.09c may play a role in sexual differentiation. Assess iodine staining patterns to evaluate sporulation.

  • Cell morphology analysis: Examine for abnormalities in cell shape, size, septation, or division patterns.

  • Subcellular localization: Track protein localization under different conditions using fluorescently-tagged constructs.

  • Gene expression profiling: Analyze transcriptome changes in knockout/overexpression strains.

For example, disruption of the similarly uncharacterized SPBC4.01 led to defects in both cell fusion and spore formation, demonstrating its role in sexual differentiation despite normal mitotic growth.

How can CRISPR-Cas9 be employed to study SPBC119.09c function?

CRISPR-Cas9 offers several powerful approaches for studying SPBC119.09c:

  • Precise gene deletion: Generate clean knockouts without marker genes.

  • Domain-specific mutations: Introduce point mutations to assess the role of specific amino acid residues.

  • Endogenous tagging: Add fluorescent or affinity tags at the genomic locus.

  • CRISPRi/CRISPRa: For conditional repression or activation of SPBC119.09c expression.

  • CRISPR screening: Perform genome-wide screens to identify genetic interactions.

Methodology considerations:

  • Design guide RNAs with minimal off-target effects

  • Include appropriate controls including non-targeting guides

  • Validate edits by sequencing

  • Assess potential compensatory mechanisms through transcriptomics

What computational methods can predict SPBC119.09c structure?

Modern computational approaches for predicting SPBC119.09c structure include:

  • AlphaFold2/RoseTTAFold: These AI-based tools provide highly accurate structure predictions, especially valuable for uncharacterized proteins.

  • Transmembrane topology prediction: Tools like TMHMM and Phobius can identify potential membrane-spanning regions in SPBC119.09c.

  • Domain identification: InterProScan and Pfam searches to identify conserved domains.

  • Molecular dynamics simulations: To study potential conformational changes and membrane interactions.

  • Protein-protein docking: To predict interactions with potential binding partners.

The amino acid sequence data available for SPBC119.09c (186 residues) is sufficient for applying these computational approaches.

How can crystallographic or cryo-EM studies of SPBC119.09c be optimized?

For structural determination of SPBC119.09c:

  • Construct optimization:

    • Design multiple truncated constructs to remove disordered regions

    • Consider fusion proteins (T4 lysozyme, BRIL) to aid crystallization

    • Remove potential glycosylation sites that might cause heterogeneity

  • Expression and purification:

    • Use E. coli systems with His-tags as demonstrated in commercial preparations

    • Test multiple detergents for membrane protein extraction

    • Employ size-exclusion chromatography to ensure monodispersity

  • Crystallization screening:

    • Test both vapor diffusion and lipidic cubic phase methods

    • Screen with and without ligands/interacting proteins

    • Consider antibody fragments to stabilize flexible regions

  • Cryo-EM considerations:

    • Use nanodiscs or amphipols to maintain native environment

    • Optimize protein concentration and grid preparation

    • Consider multi-conformational analysis

How might SPBC119.09c contribute to fundamental cellular processes in yeasts?

Based on analysis of other uncharacterized S. pombe proteins and the structural features of SPBC119.09c, it may potentially function in:

  • Membrane organization and trafficking: The hydrophobic regions suggest membrane association that could be involved in organelle structure maintenance.

  • Signaling pathways: By analogy with other pheromone-responsive proteins like SPBC4.01, it may participate in sexual differentiation signaling cascades.

  • Stress response: Many membrane proteins in yeast contribute to cellular adaptations under stress conditions.

  • Cell wall biogenesis: The protein might function in cell wall maintenance or remodeling, particularly during mating.

  • Nutrient sensing: It could participate in detecting nitrogen availability, which is critical for triggering sexual differentiation in S. pombe.

Research strategies should include systematic phenotypic analysis under diverse environmental conditions and genetic backgrounds to reveal conditional functions.

What transcriptomic approaches can provide insights into SPBC119.09c regulation?

To understand the regulatory context of SPBC119.09c:

  • RNA-Seq time course experiments:

    • During nitrogen starvation response

    • Following pheromone treatment

    • Throughout the cell cycle

    • Under various stress conditions

  • ChIP-Seq analysis:

    • Identify transcription factors that bind the SPBC119.09c promoter

    • Map histone modifications at the locus

    • Compare with known regulators of sexual differentiation genes

  • Single-cell RNA-Seq:

    • Characterize expression heterogeneity in cell populations

    • Identify co-expressed gene modules

    • Track expression dynamics during differentiation

This approach successfully identified pheromone-responsive genes like SPBC4.01 in previous studies using genomic microarrays, and modern transcriptomic methods would provide even greater resolution.

How can comparative genomics inform research on SPBC119.09c?

Comparative genomics approaches provide evolutionary context:

  • Ortholog identification:

    • Identify related proteins in other fungal species

    • Map conservation patterns across phylogenetic distances

    • Examine synteny of genomic regions

  • Functional inference:

    • Transfer functional annotations from characterized orthologs

    • Identify co-evolved gene clusters

    • Detect signatures of selection pressure

  • Structure-function correlation:

    • Map conserved residues onto predicted structural models

    • Identify potential functional sites based on evolutionary conservation

    • Design targeted mutagenesis experiments for functional validation

This evolutionary perspective can guide hypothesis generation about SPBC119.09c function and prioritize specific regions for experimental characterization.

How can genetic rescue experiments validate SPBC119.09c function?

Complementation experiments provide powerful validation:

  • Design complementation constructs:

    • Wild-type SPBC119.09c

    • Domain-specific mutants

    • Orthologs from related species

    • Chimeric proteins

  • Expression strategies:

    • Native promoter vs. inducible promoter

    • Genomic integration vs. plasmid-based expression

    • Varied expression levels

  • Phenotypic assessment:

    • Quantify rescue efficiency across multiple phenotypes

    • Test condition-dependent complementation

    • Analyze dose-dependent effects

Similar complementation approaches were effective in validating the role of other uncharacterized S. pombe proteins in sexual differentiation processes.

What approaches can detect post-translational modifications of SPBC119.09c?

To characterize potential post-translational modifications:

  • Mass spectrometry approaches:

    • Phosphoproteomics to detect phosphorylation sites

    • Glycoproteomics for glycosylation mapping

    • Ubiquitin/SUMO profiling

  • Site-specific mutagenesis:

    • Generate phospho-mimetic and phospho-null mutations

    • Test functional consequences of modifying predicted modification sites

  • Antibody-based detection:

    • Develop modification-specific antibodies

    • Use Western blotting to track modification status under different conditions

  • In vitro modification assays:

    • Test as substrate for known kinases, ubiquitin ligases, or other modifying enzymes

    • Reconstitute modification systems in vitro

These approaches would provide insights into regulatory mechanisms controlling SPBC119.09c activity and stability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.