Recombinant Schizosaccharomyces pombe Uncharacterized protein C119.16c (SPBC119.16c)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Uncharacterized protein C119.16c (SPBC119.16c) is a protein derived from the fission yeast Schizosaccharomyces pombe . The protein is also known as conserved fungal protein . The function of SPBC119.16c is not yet known .

Basic Properties

PropertyValue
OrganismSchizosaccharomyces pombe (strain 972 / ATCC 24843)
UniProt IDO42907
Amino Acid Length448
Molecular WeightThe search results do not have information about the molecular weight of the protein.
Gene NameSPBC119.16c
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
StorageStore at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .
SequenceMSIQAIVLATFDAKEGYNVENYYPGDFNVEGIEYLLFPSGIQELDNCTIFFRFQDQLCLSVFSKLQHPSFERSAFFTSVGLILSDDINFGEAVVKYGETLLYIANGLSLATLKYKFGEDASETYASEKCTSHQLSDSDFFKSLQTSAVNLEFDSLFEKLQGNKFAILGANSKELSQSYATILLDHLGPAFYCLYKFALQRKRILLISSHDDQLYSIIDMIVRLSSIKRSSDASIPILLSDLHPFYSVGLANTSTLLDNDLEEGWIACTTDTVLLSKSSLYDLALYWPDNSFNANKYPQIFNSNSIRIKPSYDDLINFKGLSRYLSFDGESSWGLTTYSLASKYIFNTSHHNLTDQEFLNENMLDYFQRYNQKLLTVLSSNAESFNVSDMQTLGLNPCHSLDKSFVSEISQIWLKKHINWQYGKYFWLRRVSLIFLASTCFLFILWKLL

Availability

Recombinant SPBC119.16c is available for purchase from various commercial sources as a recombinant protein for research purposes . It is offered with a tag, but the specific tag type is determined during the production process .

Role in Schizosaccharomyces pombe

Schizosaccharomyces pombe is a commonly studied fission yeast, sharing important gene expression mechanisms with higher eukaryotes . It serves as a model organism for studying eukaryotic RNA metabolism, heterochromatin silencing, and RNA interference .

Potential Functions and Interactions

While SPBC119.16c is currently annotated as an uncharacterized protein, studies involving Schizosaccharomyces pombe provide some context:

  • Genetic Interactions: Global network analysis in Schizosaccharomyces pombe reveals consequences of mutations in genes, which helps to dissect their distinct functional effects .

  • Cytoskeletal Links: Schizosaccharomyces pombe cdc15 homology (PCH) family members participate in cellular processes by bridging the plasma membrane and cytoskeleton .

  • Role in Gut Microbiome: Proteins from Schizosaccharomyces pombe have been identified in the stool samples of both healthy individuals and patients with colorectal cancer, suggesting a potential role of gut mycobiota in carcinogenesis .

Experimental Uses

Recombinant SPBC119.16c can be used in various experimental assays:

  • ELISA: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying antibodies against SPBC119.16c .

  • Western blotting: The search results do not have information about using it in Western blotting assays.

  • Protein-protein interaction studies: The search results do not have information about using it in protein-protein interaction studies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
SPBC119.16c; Uncharacterized protein C119.16c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC119.16c
Target Protein Sequence
MSIQAIVLATFDAKEGYNVENYYPGDFNVEGIEYLLFPSGIQELDNCTIFFRFQDQLCLS VFSKLQHPSFERSAFFTSVGLILSDDINFGEAVVKYGETLLYIANGLSLATLKYKFGEDA SETYASEKCTSHQLSDSDFFKSLQTSAVNLEFDSLFEKLQGNKFAILGANSKELSQSYAT ILLDHLGPAFYCLYKFALQRKRILLISSHDDQLYSIIDMIVRLSSIKRSSDASIPILLSD LHPFYSVGLANTSTLLDNDLEEGWIACTTDTVLLSKSSLYDLALYWPDNSFNANKYPQIF NSNSIRIKPSYDDLINFKGLSRYLSFDGESSWGLTTYSLASKYIFNTSHHNLTDQEFLNE NMLDYFQRYNQKLLTVLSSNAESFNVSDMQTLGLNPCHSLDKSFVSEISQIWLKKHINWQ YGKYFWLRRVSLIFLASTCFLFILWKLL
Uniprot No.

Target Background

Database Links
Subcellular Location
Golgi apparatus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is known about the SPBC119.16c gene in Schizosaccharomyces pombe?

SPBC119.16c is classified as an uncharacterized protein in the S. pombe genome. Based on the standard S. pombe nomenclature, "SP" indicates Schizosaccharomyces pombe, "B" designates chromosome II, "C119" refers to the cosmid location, and "16c" identifies it as the 16th open reading frame on the complementary strand. While precise functional characterization has not been established, the gene exists within the well-sequenced and annotated S. pombe genome available through PomBase (www.pombase.org)[3].

Uncharacterized proteins like SPBC119.16c are not uncommon in S. pombe. Studies of global gene expression patterns have identified numerous uncharacterized or hypothetical proteins that show significant expression changes under various conditions. For example, one comprehensive gene expression study identified 29 genes of unknown function/hypothetical proteins with altered expression under specific conditions .

Based on genomic context analysis, researchers should examine neighboring genes and genomic elements near SPBC119.16c, as spatial relationships can provide functional clues. For instance, proximity to elements like transposable elements may indicate regions of genomic instability or regulatory hotspots, as seen with genes located near transposable element SPAC167.08 (Tf2-2) .

What bioinformatic approaches can predict potential functions of SPBC119.16c?

When investigating an uncharacterized protein like SPBC119.16c, multiple bioinformatic approaches should be employed to predict potential functions:

  • Sequence homology analysis: Use BLAST, HHpred, and HMMER to identify distant homologs across species, focusing on conserved domains rather than whole-protein similarity.

  • Structural prediction: Utilize AlphaFold or RoseTTAFold to predict tertiary structure, which may reveal functional sites not evident from sequence alone.

  • Subcellular localization prediction: Apply tools like TargetP, PSORT, and DeepLoc to identify potential targeting signals for secretory pathway, mitochondria, or nucleus.

  • Post-translational modification sites: Predict glycosylation, phosphorylation, and other modifications using NetNGlyc, NetPhos, and similar tools.

  • Interaction network prediction: Use STRING and PrePPI to identify potential protein-protein interactions based on co-expression, genomic neighborhood, and text mining.

The reliability of these predictions can be assessed through consensus approaches, comparing outputs from multiple tools. Since S. pombe post-translational modification patterns, particularly glycosylation, closely resemble those in mammalian cells, prediction tools trained on mammalian data may provide relevant insights for SPBC119.16c .

What expression patterns might indicate involvement of SPBC119.16c in specific cellular processes?

Expression pattern analysis is a powerful approach for generating hypotheses about uncharacterized protein function. For SPBC119.16c, researchers should examine:

  • Correlation with known functional groups: If SPBC119.16c expression changes parallel genes in specific categories like energy production, carbohydrate metabolism, stress response, or proteolysis, this suggests functional association with these processes .

  • Temporal expression profiles: Significant changes during specific growth phases or stress responses may indicate function. For example, if SPBC119.16c expression changes in a "remarkably continuous manner" throughout growth curves, this strengthens confidence in its biological relevance to growth-phase dependent processes .

  • Consistency across experimental conditions: Expression changes of ≥2-fold in multiple conditions (e.g., "in two or more days of the growth curve or, alternatively, in both strains") indicates robust regulation rather than experimental noise .

The table below illustrates potential correlation patterns to investigate:

Functional CategoryExample S. pombe GenesCorrelation Indicates
Energy productionSPBC23G7.10c, SPAC513.02Mitochondrial or metabolic role
Carbohydrate metabolismeno102+, tms1+, fbp1+Role in carbon utilization
Stress responsehsp16+, cta1+, hsp9+Involvement in cellular protection
Protein secretionRelated secretory componentsRole in protein trafficking

Microarray or RNA-seq experiments comparing wild-type and mutant strains under various conditions will provide comprehensive expression data for correlation analysis .

What expression systems are recommended for recombinant production of SPBC119.16c?

For recombinant production of SPBC119.16c, several expression systems can be utilized, each with specific advantages:

  • Homologous expression in S. pombe: This approach is often optimal for native S. pombe proteins, as it maintains proper post-translational modifications and folding. S. pombe is well-characterized for protein folding, quality control, and post-translational modifications that closely resemble mammalian systems, particularly regarding glycosylation .

For homologous expression, the following vectors have proven effective:

  • pREP1 vector containing the nmt1 promoter for constitutive expression

  • pCAD1 integrative expression vector for chromosomal integration

A dual approach using both integrative and episomal vectors can enhance protein production. The methodology involves:

  • Amplifying SPBC119.16c from genomic DNA using PCR with primers containing appropriate restriction sites (e.g., NdeI for 5' and BamHI for 3')

  • Cloning the amplified gene into both pCAD1 (integrative) and pREP1 (episomal) vectors

  • Sequential transformation of S. pombe, first with the integrative vector and then with the episomal vector

  • Alternative expression hosts: While S. pombe itself provides advantages for expressing its native proteins, commercially established systems like Saccharomyces cerevisiae and Pichia pastoris could be considered if higher yields are required, though with potential compromises in post-translational processing authenticity .

How should experimental design address the challenges of studying an uncharacterized protein?

Studying an uncharacterized protein like SPBC119.16c requires a comprehensive experimental design that addresses multiple aspects simultaneously:

  • Expression and localization analysis:

    • Create fluorescently tagged versions of SPBC119.16c to determine subcellular localization

    • Monitor expression under diverse conditions (different growth phases, stressors, nutrients)

    • Validate expression changes using quantitative proteomics approaches like iTRAQ labeling

  • Deletion and overexpression studies:

    • Generate knockout strains to identify phenotypes under standard and stress conditions

    • Create overexpression strains using nmt1 promoter-driven expression

    • Perform growth curves, stress sensitivity assays, and microscopic analysis of both strain types

  • Protein-protein interaction mapping:

    • Use affinity purification coupled with mass spectrometry to identify binding partners

    • Perform yeast two-hybrid screens against S. pombe libraries

    • Validate key interactions using co-immunoprecipitation and bimolecular fluorescence complementation

  • Comparative genomics and proteomics:

    • Compare knockout vs. wild-type strains using RNA-seq and proteomics

    • Apply statistical criteria for significant changes: "selecting those genes with expression changes of twofold or more in two or more days of the growth curve or, alternatively, in both strains"

    • Look for coherent patterns among significantly altered genes to infer functional relationships

  • Metabolic impact assessment:

    • Analyze changes in metabolites when SPBC119.16c is deleted or overexpressed

    • Focus on pathways like amino acid biosynthesis that have proven informative in previous S. pombe studies

Each experimental approach should include appropriate controls and be designed to generate data that can be analyzed statistically to distinguish biologically significant findings from experimental artifacts.

What purification strategies are effective for recombinant SPBC119.16c protein?

Purifying recombinant SPBC119.16c requires a systematic approach tailored to S. pombe protein extraction challenges. Based on established protocols, the following strategy is recommended:

  • Cell lysis optimization:

    • Resuspend S. pombe cells in appropriate lysis buffer (e.g., 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5 mM EDTA with protease inhibitors)

    • Disrupt cells mechanically using glass beads at 4°C, as S. pombe has a robust cell wall requiring vigorous disruption

    • Clarify lysate by centrifugation at 16,000 × g for 15 min at 4°C to remove cell debris

  • Initial protein characterization:

    • Determine protein concentration using Bradford assay

    • Perform buffer exchange and concentration using ultrafiltration with Amicon centrifugal filter units (MWCO: 3 kDa)

    • Analyze solubility and initial purity by SDS-PAGE

  • Chromatography-based purification:
    For affinity-tagged SPBC119.16c:

    Tag TypeChromatography MethodElution Conditions
    His-tagImmobilized metal affinityImidazole gradient (50-300 mM)
    GST-tagGlutathione affinityReduced glutathione (10 mM)
    MBP-tagAmylose resinMaltose (10 mM)
  • Additional purification steps:

    • Size exclusion chromatography for higher purity and oligomeric state assessment

    • Ion exchange chromatography based on theoretical isoelectric point

    • Hydrophobic interaction chromatography if applicable

  • Protein quality assessment:

    • Verify purity by SDS-PAGE and western blotting

    • Confirm identity by mass spectrometry

    • Assess proper folding using circular dichroism

    • Analyze post-translational modifications, leveraging S. pombe's mammalian-like glycosylation patterns

This purification strategy combines specific methods validated for S. pombe proteins with standard protein purification approaches, adaptable to the unique properties of SPBC119.16c once initial characterization data becomes available.

How should researchers analyze transcriptomic and proteomic data to infer SPBC119.16c function?

Analyzing multi-omics data to infer SPBC119.16c function requires systematic integration of transcriptomic and proteomic datasets using these methodological approaches:

  • Establishing significance thresholds:

    • For initial screening, apply a ≥2-fold change criterion across multiple conditions

    • For higher confidence, require consistent changes across at least three experimental conditions

    • Apply appropriate statistical tests with multiple-testing correction

  • Correlation analysis:

    • Calculate correlation coefficients between SPBC119.16c and all other genes across conditions

    • Group highly correlated genes by function to identify potential pathways

    • Analyze co-expression with genes of known function for guilt-by-association inference

  • Functional enrichment analysis:

    • Determine if genes co-regulated with SPBC119.16c are enriched in specific categories

    • Focus on categories like energy production, carbohydrate metabolism, stress response, and protein secretion that show coordinated regulation in S. pombe

  • Comparative analysis across conditions:

    • Compare expression patterns between growth curves and survival conditions

    • Look for continuous patterns of expression change that provide "additional confidence that expression changes scored as significant were not false positives"

  • Integration of transcriptomic and proteomic data:

    • Correlate mRNA and protein level changes for SPBC119.16c and related genes

    • Use quantitative proteomics methods like iTRAQ for reliable protein quantification

    • Identify post-transcriptional regulation by finding discrepancies between transcript and protein changes

  • Network analysis:

    • Construct protein-protein interaction networks centered on SPBC119.16c

    • Identify pathway membership through network topology analysis

    • Apply graph theory algorithms to define functional modules

  • Visualization of multi-dimensional data:

    • Generate heatmaps clustering genes by expression patterns

    • Use principal component analysis to identify major sources of variation

    • Create pathway maps highlighting SPBC119.16c's position within cellular processes

This methodological framework enables researchers to move from raw data to functional hypotheses about SPBC119.16c that can be experimentally validated.

How can contradictory results from different functional prediction tools for SPBC119.16c be resolved?

Resolving contradictory predictions for uncharacterized proteins like SPBC119.16c requires systematic evaluation and prioritization:

  • Evaluate the reliability of each prediction method:

    • Consider tool-specific confidence scores and p-values

    • Assess whether the tool is appropriate for S. pombe proteins

    • Review the underlying algorithm (homology-based, ab initio, or machine learning)

    • Determine if the tool's training data included fission yeast proteins

  • Prioritize predictions based on multiple lines of evidence:

    • Give greater weight to functions predicted by multiple independent tools

    • Consider evolutionary conservation of predicted functions in related species

    • Evaluate consistency with expression data patterns

    • Assess concordance with predicted protein structure

  • Design targeted validation experiments for conflicting predictions:

    Prediction TypeConflicting ResultsValidation Approach
    Enzymatic activityDifferent substrate specificitiesBiochemical assays with purified protein against multiple substrates
    Subcellular localizationER vs. Golgi vs. Plasma membraneFluorescent tagging with colocalization markers for each compartment
    Pathway involvementMetabolic vs. SignalingMetabolomics analysis and phosphoproteomics in knockout strains
    Protein interactionDifferent binding partnersYeast two-hybrid and co-immunoprecipitation with candidate partners
  • Consider genomic context:

    • Examine if neighboring genes provide functional clues

    • Investigate if SPBC119.16c is near hotspots for DNA excision or transposable elements

    • Analyze the promoter region for transcription factor binding sites

  • Integrate with experimental data:

    • Test whether expression patterns correlate with genes of known function

    • Use proteomics approaches to identify changes in cellular pathways when SPBC119.16c is perturbed

    • Examine response to environmental conditions like stress or nutrient limitation

  • Apply Bayesian integration framework:

    • Assign prior probabilities based on prediction tool accuracy

    • Update with experimental evidence

    • Calculate posterior probabilities for each functional hypothesis

This methodological framework transforms conflicting predictions into an organized research plan that systematically narrows the range of possible functions for SPBC119.16c.

How should researchers interpret subtle phenotypes in SPBC119.16c mutant strains?

Interpreting subtle phenotypes in SPBC119.16c mutant strains requires sophisticated analytical approaches to distinguish biologically meaningful changes from experimental noise:

  • Quantitative phenotypic analysis:

    • Measure growth parameters precisely: lag phase duration, doubling time, maximum density

    • Track cellular morphology using automated image analysis

    • Apply rigorous statistical analysis with appropriate sample sizes (n>30 for each condition)

  • Condition-dependent phenotyping:

    • Test growth under varied conditions: temperature ranges, nutrient limitations, osmotic stress

    • Examine response to chemical stressors targeting different cellular processes

    • Assess phenotypes across the complete cell cycle

  • Enhanced detection methods:

    • Use competition assays between wild-type and mutant strains for detecting slight fitness differences

    • Apply flow cytometry for single-cell analysis of population heterogeneity

    • Implement time-lapse microscopy to capture dynamic phenotypes missed in endpoint measurements

  • Genetic background considerations:

    • Create SPBC119.16c deletions in multiple genetic backgrounds

    • Test for synthetic phenotypes with deletions in functionally related genes

    • Consider the genomic context and potential compensatory mechanisms

  • Multi-omics characterization:

    • Use proteomics to identify subtle protein expression changes in mutants

    • Apply metabolomics to detect alterations in metabolic profiles

    • Leverage the quantitative approach described in research: "selecting those genes with expression changes of twofold or more in two or more days of the growth curve or, alternatively, in both strains"

  • Pathway-focused analysis:

    • Examine specific pathways in detail rather than global phenotypes

    • Focus on energy production and carbohydrate metabolism pathways that frequently show coordinated regulation in S. pombe

    • Consider stress response pathways involving genes like hsp16+, cta1+, and hsp9+

  • Temporal dynamics:

    • Monitor phenotypes over time rather than at single timepoints

    • Look for "remarkably continuous manner in which gene expression changed throughout the growth curve" as an indicator of biological significance

  • Complementation testing:

    • Confirm phenotypes are due to SPBC119.16c by reintroducing the wild-type gene

    • Use both integrative (pCAD1) and episomal (pREP1) vectors for complementation

    • Test domain-specific complementation to identify functional regions

This comprehensive approach ensures that even subtle phenotypes can be reliably interpreted as biologically significant, leading to meaningful insights about SPBC119.16c function.

How might SPBC119.16c be involved in S. pombe stress response pathways?

Investigating SPBC119.16c's potential involvement in stress response requires a sophisticated research strategy that integrates multiple approaches:

  • Expression correlation analysis:

    • Compare SPBC119.16c expression patterns with known stress response genes like hsp16+, cta1+, hsp9+, ish1+, and pyp2+

    • Analyze expression across diverse stressors: oxidative, heat, osmotic, nutrient deprivation

    • Apply stringent criteria for significant correlation: expression changes of ≥2-fold in multiple conditions

  • Promoter analysis:

    • Identify stress-responsive elements in the SPBC119.16c promoter

    • Compare with promoters of established stress response genes

    • Perform chromatin immunoprecipitation (ChIP) to determine if stress-activated transcription factors (e.g., Atf1, Pap1, Hsf1) bind the SPBC119.16c promoter

  • Phenotypic characterization of mutants:

    • Create SPBC119.16c deletion strains using approaches similar to those used for other S. pombe genes

    • Test growth and survival under various stressors

    • Examine whether overexpression affects stress tolerance

  • Pathway-specific assays:

    Stress PathwaySpecific AssaysRelevance
    Oxidative stressH₂O₂ sensitivity, catalase activityConnection to cta1+ response
    Heat shockThermotolerance, protein aggregationRelationship to hsp16+, hsp9+
    Nutrient stressGrowth in limited media, autophagy markersEnergy production pathways
    Cell wall stressCalcofluor white/SDS sensitivityPotential cell organization role
  • Protein-level analysis:

    • Track SPBC119.16c protein levels, modifications, and localization during stress

    • Identify stress-dependent interaction partners

    • Apply quantitative proteomics approaches as described for S. pombe

  • Genetic interaction mapping:

    • Test for synthetic interactions with known stress response genes

    • Determine if SPBC119.16c deletion exacerbates or suppresses phenotypes of stress pathway mutants

    • Perform epistasis analysis to position SPBC119.16c within stress signaling cascades

  • Metabolic impact assessment:

    • Measure changes in key metabolites during stress in wild-type vs. SPBC119.16c mutants

    • Focus on energy production and carbohydrate metabolism pathways frequently altered during stress

    • Analyze membrane composition changes, which can affect stress tolerance

This comprehensive approach will systematically uncover any functional connections between SPBC119.16c and S. pombe stress response mechanisms, even if the relationships are complex or condition-specific.

What role might SPBC119.16c play in protein secretion or quality control in S. pombe?

Investigating SPBC119.16c's potential role in protein secretion or quality control requires leveraging S. pombe's advantages as a secretion model system:

  • Sequence and structural feature analysis:

    • Examine SPBC119.16c for secretory pathway-related motifs: signal peptides, transmembrane domains, ER retention signals

    • Search for domains associated with protein folding, quality control, or trafficking

    • Compare with known secretory pathway components in S. pombe and other eukaryotes

  • Subcellular localization mapping:

    • Create fluorescently tagged SPBC119.16c using established vectors (pREP1, pCAD1)

    • Perform co-localization studies with markers for ER, Golgi, vesicles, and plasma membrane

    • Use live-cell imaging to track dynamics during secretory pathway stress

  • Impact on recombinant protein secretion:

    • Compare secretion efficiency of reporter proteins in wild-type vs. SPBC119.16c mutants

    • Assess glycosylation patterns, leveraging S. pombe's mammalian-like modification systems

    • Measure secretory flux rates for multiple cargo proteins

  • Response to secretory pathway perturbations:

    Secretory Pathway StressAssay MethodPotential Outcome
    ER stress (tunicamycin)UPR reporter activationSPBC119.16c role in protein folding
    Golgi disruption (Brefeldin A)Secretion block recoveryFunction in Golgi-ER retrieval
    Exocytosis inhibitionVesicle accumulation patternsRole in vesicle fusion
    Glycosylation inhibitionGlycoprotein processing changesInvolvement in quality control
  • Proteomics-based interaction mapping:

    • Identify SPBC119.16c interaction partners using approaches like BioID proximity labeling

    • Compare interactome under normal and stressed conditions

    • Apply quantitative proteomics methodologies established for S. pombe

  • Effects on global secretome:

    • Analyze secreted proteins in culture media from wild-type vs. mutant strains

    • Quantify differences in abundance, processing, and modification patterns

    • Focus on known S. pombe secreted proteins as markers

  • Integration with secretory pathway genomics:

    • Create double mutants with established secretory pathway components

    • Screen for synthetic growth defects or suppression relationships

    • Position SPBC119.16c within the secretory pathway genetic interaction network

  • Leveraging S. pombe advantages:

    • Exploit S. pombe's well-characterized protein folding and quality control mechanisms

    • Utilize its mammalian-like glycosylation patterns for studying secretory processing

    • Apply comparative proteome analysis methods established for secretion studies in S. pombe

This systematic approach will reveal whether SPBC119.16c functions within the secretory pathway and characterize its specific role in protein production, processing, trafficking, or quality control.

How can CRISPR-Cas9 genome editing be optimized for studying SPBC119.16c function?

Optimizing CRISPR-Cas9 genome editing for SPBC119.16c functional studies requires addressing S. pombe-specific considerations while leveraging its well-characterized genome:

  • Guide RNA design optimization:

    • Utilize S. pombe's well-sequenced and annotated genome for precise gRNA targeting

    • Design multiple gRNAs targeting different regions of SPBC119.16c

    • Score gRNAs for specificity using S. pombe genome databases to minimize off-targets

    • Consider chromatin accessibility at the SPBC119.16c locus when selecting target sites

  • Delivery system selection:

    • Adapt established S. pombe transformation protocols using cryocompetent cells

    • Compare efficiency of plasmid-based vs. ribonucleoprotein (RNP) delivery

    • Optimize transformation conditions specifically for CRISPR components

  • Homology-directed repair enhancement:

    HDR ParameterOptimization StrategyExpected Improvement
    Homology arm lengthTest 40-80 bp rangesMaximize integration efficiency
    Template designSingle vs. double-stranded DNABalance efficiency and fidelity
    Cell cycle synchronizationNitrogen starvation or chemical arrestIncrease HDR frequency
    Selection markerUtilize established S. pombe markersFacilitate edited cell isolation
  • Multiplex editing approaches:

    • Simultaneously modify SPBC119.16c and potential interacting partners

    • Create tagged versions at the endogenous locus for localization studies

    • Generate conditional alleles using the nmt1 promoter system described in search result

  • Verification strategy implementation:

    • Design PCR primers flanking the edited region for initial screening

    • Sequence the entire locus to confirm precise editing without unwanted mutations

    • Verify expression changes using established microarray or RNA-seq protocols

    • Confirm protein-level effects using proteomics approaches

  • Advanced CRISPR applications:

    • Implement CRISPRi for transcriptional repression without DNA cleavage

    • Apply CRISPRa for transcriptional activation to study overexpression phenotypes

    • Utilize base editing for introducing point mutations without double-strand breaks

  • Integration with existing genetic tools:

    • Combine CRISPR-mediated modifications with classical S. pombe genetics

    • Create genomic integration systems similar to the pCAD1 integrative vector approach

    • Design compatible selection strategies that work with established S. pombe markers

  • Phenotypic validation framework:

    • Establish quantitative assays to detect even subtle phenotypes

    • Apply growth analysis in varying conditions to identify condition-specific effects

    • Implement proteome-wide screening to detect global effects of SPBC119.16c modification

This comprehensive optimization strategy will maximize the efficiency and precision of CRISPR-Cas9 genome editing for studying SPBC119.16c, facilitating sophisticated functional genomics analyses of this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.