Recombinant Schizosaccharomyces pombe Uncharacterized protein C11B10.07c (pi004, SPACTOKYO_453.33c, SPBC11B10.07c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ivn1; pi004; SPACTOKYO_453.33c; SPBC11B10.07c; Invasion protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
ivn1
Target Protein Sequence
MSQTEIVKKPKHKRFKRPDKSRFVQQTLPAWQFIFTPWTVLPLLFLLGIVFAPLGAGMFV ASRRVKELRIDYTDCMNIGDEFKQVPSTNIEFQYKNVKNVTAMWKSSGDVCTLRFQIPEE MTSPVFAFYRLKNFYQNHRRYTVSADMFQLLGEARTVAQLKSYGFCKPLEANEEGKPYYP CGIIANSLFNDSYSSLLRYESFDSSNSLGLYNMTTNGTAWPEDRERYKKTKYNASQIVPP PNWAKMFPNGYTDDNIPDVSTWDAFQIWMRAAALPTFSKLALRNVTTALQPGIYEMNITY NFPVTEYKGTKTIMFSTTSVIGGKNYFLGILYFVIGGLCAASGVILSIACLIKPRRVGDP RYLSWNRGKSS
Uniprot No.

Target Background

Function

Required for invasive growth.

Database Links
Protein Families
CDC50/LEM3 family
Subcellular Location
Endoplasmic reticulum. Membrane; Multi-pass membrane protein.

Q&A

Why is Schizosaccharomyces pombe a suitable model organism for studying uncharacterized proteins?

S. pombe is well-suited for protein characterization studies for several reasons:

  • It has only three chromosomes, producing many viable meiotic products even in recombination-deficient strains (10-20% as many viable spores as wild type)

  • The commonly used strains are isogenic, facilitating allele exchange and result comparison between laboratories

  • S. pombe is more similar to the last common ancestor of humans and fungi than S. cerevisiae

  • It shows higher conservation in chromosome structure and function genes compared to S. cerevisiae

  • It possesses similarities to humans in several processes including RNA splicing, DNA repair, and telomere function

These characteristics make it an excellent system for studying uncharacterized proteins, with powerful molecular genetics and simple culturing conditions similar to S. cerevisiae .

What expression systems are commonly used for recombinant S. pombe proteins?

For recombinant expression of S. pombe proteins like C11B10.07c, E. coli is frequently used as the host organism . The expression system typically includes:

  • His-tagging for purification purposes

  • Protein expression in lyophilized powder form

  • Storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Recommended reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol for long-term storage at -20°C/-80°C

Alternative expression systems include the use of the native S. pombe system, particularly when studying protein function in its natural cellular context. Expression can be controlled using:

  • The nmt1 promoter system (repressed by thiamine)

  • The urg1 promoter system, which allows induction within 30 minutes (compared to 14-20 hours for nmt1)

How should I design experiments to characterize the function of an uncharacterized protein like C11B10.07c?

When designing experiments to characterize C11B10.07c, consider the following approach:

  • Define Clear Objectives: Establish specific goals with proper experimental controls

  • Understand the Literature: Find and analyze relevant primary literature

  • Maximize Efficiency: Limit time required while maintaining experimental rigor

  • Foster Collaboration: Enhance work relationships between lab members

To ensure good experimental design, use the TIED (Tool to Assess Interrelated Experimental Design) principles, focusing on five key components:

ComponentCriteria to Satisfy
Hypothesis FormationClear statement of question and variables
Experimental/Control GroupsAppropriate comparison groups that isolate the variable of interest
Treatments/Independent VariablesWell-defined manipulations that test the hypothesis
Data CollectionMeasurements that address all variables stated in the hypothesis
ObservationsPotential outcomes that could be gleaned from the proposed data collection

It's crucial to ensure alignment between these components, where each aspect of the experimental design is connected to and supports the others.

What genetic approaches can be used to study C11B10.07c function in S. pombe?

Several genetic approaches can be employed to study C11B10.07c:

  • Gene Deletion/Knockout Studies: Create strains lacking C11B10.07c to observe phenotypic effects

  • Gene Overexpression: Use the nmt1 promoter system for constitutive expression via plasmid or chromosomal integration

  • Genetic Interaction Mapping: Cross C11B10.07c mutants with other known mutants to identify genetic pathways

  • Chromosomal Integration Studies: Integrate modified versions of C11B10.07c to study effects of specific mutations

For gene deletion studies, researchers should consider the following protocol:

  • Create a deletion cassette containing a selectable marker

  • Transform S. pombe cells and select for integrants

  • Confirm deletion by PCR and/or Southern blotting

  • Perform complementation studies to verify phenotypes are due to loss of C11B10.07c

What methods are available for analyzing protein-protein interactions involving C11B10.07c?

To analyze protein-protein interactions involving C11B10.07c, consider these methodological approaches:

  • Yeast Two-Hybrid (Y2H): Use C11B10.07c as bait to screen for interacting proteins

  • Co-immunoprecipitation (Co-IP): Pull down C11B10.07c and identify binding partners

  • Pull-down Assays: Use recombinant His-tagged C11B10.07c to pull down interacting proteins from cell lysates

  • Bimolecular Fluorescence Complementation (BiFC): Visualize protein interactions in vivo

  • Proximity Labeling: Use BioID or APEX2 fusions to identify proximal proteins

When designing these experiments, ensure proper controls are included:

  • Positive controls (known interacting proteins)

  • Negative controls (proteins not expected to interact)

  • Empty vector controls

  • Input samples for pull-downs and Co-IPs

How can I design a comprehensive study to determine the subcellular localization of C11B10.07c throughout the cell cycle?

To determine subcellular localization of C11B10.07c throughout the cell cycle:

  • Create Fluorescent Protein Fusions:

    • Generate N- and C-terminal GFP (or similar fluorophore) fusions of C11B10.07c

    • Confirm functionality of fusion proteins

    • Express under native promoter to maintain physiological expression levels

  • Live Cell Imaging Protocol:

    • Synchronize cells using one of these methods:

      • Nitrogen starvation and release

      • cdc25-22 temperature-sensitive mutant

      • Lactose gradient centrifugation

    • Collect images at defined time points (every 20 minutes for 4-6 hours)

    • Co-stain with markers for specific cell cycle phases

  • Quantitative Analysis:

    • Measure fluorescence intensity in different cellular compartments

    • Track changes in localization relative to cell cycle markers

    • Plot localization patterns against time and cell cycle stage

  • Complementary Approaches:

    • Perform immunogold electron microscopy for high-resolution localization

    • Use subcellular fractionation followed by western blotting

    • Employ proximity-based labeling (BioID) to confirm localization

What approaches can be used to study the role of C11B10.07c in meiotic recombination?

To study the potential role of C11B10.07c in meiotic recombination:

  • Generate Specific Mutants:

    • Create deletion mutants

    • Develop point mutations in key domains

    • Construct temperature-sensitive alleles

  • Assay Meiotic Recombination Rates:

    • Measure intragenic recombination (gene conversion)

    • Quantify intergenic recombination (crossing-over)

    • Assess spore viability

    • Perform both random spore and tetrad analyses

  • Specialized Recombination Assays:

    • Use the "return-to-growth" assay to study recombination repair of double-strand breaks

    • Employ site-specific recombination systems

    • Integrate reporter constructs to measure recombination at specific loci

  • Examine DNA Damage Response:

    • Test sensitivity to DNA-damaging agents (e.g., methyl methanesulfonate, hydroxyurea)

    • Analyze checkpoint activation

    • Study formation and resolution of recombination intermediates

The following table outlines key assays and their applications:

How can comparative proteomics be used to understand the function of C11B10.07c?

Comparative proteomics offers powerful approaches to elucidate C11B10.07c function:

  • Differential Expression Analysis:

    • Compare proteomes of wild-type and C11B10.07c deletion strains

    • Use two-dimensional LC coupled offline to MALDI MS

    • Implement a pooling scheme for multidimensional separation to reduce measurement time

    • Generate quantitative information via isobaric labeling using the iTRAQ approach

    • Apply a global internal standard approach

  • Protein Interaction Network Mapping:

    • Perform affinity purification-mass spectrometry (AP-MS) using tagged C11B10.07c

    • Identify protein complexes containing C11B10.07c

    • Map interaction changes under different conditions (stress, cell cycle stages)

  • Post-translational Modification Analysis:

    • Identify phosphorylation, ubiquitination, SUMOylation, or other modifications

    • Map modification sites using MS/MS

    • Correlate modifications with cellular conditions or stress responses

  • Metabolic Labeling Approaches:

    • Use SILAC (Stable Isotope Labeling with Amino acids in Cell culture)

    • Track protein turnover rates

    • Compare synthesis and degradation rates between conditions

The proteomics workflow should include:

  • Sample preparation with careful extraction conditions

  • Protein digestion with sequence-specific proteases

  • Multidimensional separation techniques

  • High-resolution mass spectrometry

  • Bioinformatic analysis using appropriate software platforms

How do I troubleshoot low expression yields of recombinant C11B10.07c protein?

When facing low expression yields of recombinant C11B10.07c, consider this systematic troubleshooting approach:

  • Expression System Optimization:

    • Test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Optimize induction conditions (temperature, IPTG concentration, induction time)

    • Try chaperone co-expression to improve folding

    • Consider expression as fusion protein (MBP, GST, SUMO)

  • Codon Optimization:

    • Analyze for rare codons in the C11B10.07c sequence

    • Synthesize codon-optimized gene for E. coli expression

    • Consider using Rosetta strains that supply rare tRNAs

  • Solubility Enhancement:

    • Test various lysis buffers with different salt concentrations and detergents

    • Add solubility enhancers (glycerol, sorbitol, arginine)

    • Try auto-induction media instead of IPTG induction

    • Consider native S. pombe expression system as alternative

  • Protein Stability Measures:

    • Include protease inhibitors during purification

    • Test multiple purification temperatures (4°C vs room temperature)

    • Analyze protein stability in various storage buffers

    • Consider addition of reducing agents if protein contains cysteines

If recombinant expression continues to be problematic, consider expressing in S. pombe using the nmt1 promoter system, which can be tightly regulated by thiamine levels, or the urg1 promoter for rapid induction .

How can I interpret contradictory results from different experimental approaches studying C11B10.07c?

When facing contradictory results in C11B10.07c studies:

  • Conduct Comprehensive Literature Analysis:

    • Use targeted student-centric journal club approach to examine contradictions

    • Create a screencast presentation summarizing conflicting findings

    • Organize a two-session group discussion in journal club format

  • Methodological Cross-Examination:

    • Systematically compare experimental designs that produced contradictory results

    • Evaluate whether differences in strain backgrounds could explain discrepancies

    • Consider whether genetic background mutations might be present

    • Examine differences in growth conditions or assay protocols

  • Independent Verification:

    • Reproduce key experiments using standardized protocols

    • Use multiple methodological approaches to test the same hypothesis

    • Employ both genetic and biochemical techniques to cross-validate findings

    • Consider whether C11B10.07c might have context-dependent functions

  • Data Integration Strategies:

    • Create a comprehensive model that attempts to reconcile contradictory results

    • Consider whether post-translational modifications might explain different observations

    • Examine whether protein complexes differ under various experimental conditions

    • Test whether environmental factors influence protein function

What statistical approaches are most appropriate for analyzing functional genomics data related to C11B10.07c?

For robust statistical analysis of C11B10.07c functional genomics data:

  • Experimental Design Considerations:

    • Ensure proper biological and technical replicates

    • Include appropriate controls for all variables

    • Use randomization and blinding where possible

    • Consider power analysis to determine sample size

  • Differential Expression Analysis:

    • For RNA-seq or proteomics data, use:

      • DESeq2 or edgeR for count-based data

      • limma for continuous data

      • Consider batch effect correction using ComBat or RUVSeq

    • Apply appropriate multiple testing correction (Benjamini-Hochberg)

  • Network Analysis:

    • Use STRING, Cytoscape, or similar tools for interaction networks

    • Apply WGCNA for co-expression network analysis

    • Consider Bayesian networks for causal relationship inference

    • Perform enrichment analysis using GO terms or KEGG pathways

  • Comprehensive Data Integration:

    • Implement multivariate analysis methods (PCA, PLSDA)

    • Consider machine learning approaches for pattern recognition

    • Use visualization tools to identify relationships between datasets

    • Develop models that incorporate data from multiple experimental approaches

For joint probability analyses, consider using:

  • Copula-based methods (particularly the Gumbel-Hougaard copula)

  • Total probability methods with appropriate conditional probability matrices

What emerging technologies could advance our understanding of uncharacterized proteins like C11B10.07c?

Emerging technologies for studying uncharacterized proteins like C11B10.07c include:

  • CRISPR-Cas9 Applications:

    • Precise genome editing for functional studies

    • CRISPRi for targeted gene repression

    • CRISPRa for gene activation

    • Base editors for introducing specific mutations without double-strand breaks

  • Single-Cell Technologies:

    • Single-cell RNA-seq to examine cell-to-cell variability in response to C11B10.07c perturbation

    • Single-cell proteomics to analyze protein-level changes

    • Live-cell imaging with advanced microscopy techniques

    • Microfluidics for monitoring single cells over time

  • Structural Biology Approaches:

    • Cryo-EM for protein structure determination without crystallization

    • AlphaFold2 and similar AI tools for structure prediction

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural analysis

    • Integrative structural biology combining multiple techniques

  • Next-Generation Sequencing Applications:

    • Complete sequences of S. pombe subtelomeric homologous regions

    • Long-read sequencing to identify structural variants

    • Ribosome profiling to study translation dynamics

    • ATAC-seq for chromatin accessibility

How might studying C11B10.07c contribute to our understanding of evolutionarily conserved processes?

Studying C11B10.07c may provide insights into evolutionarily conserved processes through:

  • Comparative Genomics Approaches:

    • Identify orthologs in other species using sequence similarity and synteny analysis

    • Compare function of orthologs across evolutionary distances

    • Study conservation of protein domains and motifs

    • Examine whether function is preserved across species barriers

  • Evolutionary Rate Analysis:

    • Compare substitution rates with other genes to determine selective pressure

    • Analyze whether the gene is subject to positive or purifying selection

    • Examine whether subtelomeric location influences evolutionary rate

    • Study paralogs if present in S. pombe genome

  • Functional Conservation Testing:

    • Express human orthologs in S. pombe deletion mutants to test complementation

    • Compare protein interaction networks between species

    • Examine whether regulatory mechanisms are conserved

    • Test whether C11B10.07c function relates to known conserved cellular processes

  • Relevance to Human Disease:

    • Investigate whether human orthologs are implicated in diseases

    • Study cellular pathways that might be conserved between S. pombe and humans

    • Examine potential as a model for studying pathogenic mechanisms

    • Consider therapeutic implications if function is determined

This research is particularly valuable as S. pombe shows higher conservation in chromosome structure and function genes compared to S. cerevisiae, making findings potentially more relevant to human biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.