Recombinant Schizosaccharomyces pombe Uncharacterized protein C1271.08c (SPBC1271.08c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer requirements.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
SPBC1271.08c; Uncharacterized protein C1271.08c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC1271.08c
Target Protein Sequence
MLISRSSMPNLQKRHSDFKTPVYISRSISILNKIFHPCMYIYSRGITNDTYSSDTYELDW YDLGFVHFSKWVELAWCFLTLATWSFMKLLKTLRIVIYICTSDHWTHSLRFYYIELSKIL LYLLICGVSLYGAIRIFINL
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SPBC1271.08c and what do we know about it?

SPBC1271.08c is an uncharacterized protein from the fission yeast Schizosaccharomyces pombe (strain 972 / ATCC 24843). It is identified in UniProt with accession number O94341 and ID YHM8_SCHPO . According to systematic gene deletion studies, SPBC1271.08c is classified as a viable gene (Class V), meaning its deletion does not result in lethality under standard laboratory growth conditions . It is located on chromosome 2 between SPBC1271.07c (an acetyltransferase) and SPBC1271.09 (a gene with homology to YCR098c/GIT1) .

Is SPBC1271.08c essential for S. pombe survival?

No, SPBC1271.08c is not essential for S. pombe survival under standard laboratory conditions. In a pilot gene deletion project assessing genome-wide essentiality, SPBC1271.08c was classified as "viable" (Class V) . This contrasts with many other genes in the same chromosomal region, such as SPBC1271.13 and SPBC1271.02/stt3, which were classified as lethal upon deletion. This viability information is valuable for designing knockout studies without compromising cell survival.

Gene nameClassDeletionDeletion of closest S. cerevisiae homolog
SPBC1271.08cVviable
SPBC1271.07cIVviable
SPBC1271.09Iaviableviable
SPBC1271.13Ialethalviable

Table 1: Essentiality data for SPBC1271.08c and neighboring genes

What expression systems are recommended for recombinant SPBC1271.08c production?

For recombinant SPBC1271.08c production, multiple expression systems have been successfully employed:

  • E. coli expression system: Most commonly used due to high yield and simplicity. Particularly suitable for structural studies where post-translational modifications are not critical .

  • Yeast expression system: Recommended when native post-translational modifications may be important. Host strains like SMD1168, GS115, and X-33 have been used successfully .

  • Insect cell expression: Sf9, Sf21, and High Five cell lines can be used when complex eukaryotic processing is required .

  • Mammalian expression systems: 293T, CHO, and COS-7 cells are options for studies requiring mammalian-type modifications .

The choice of system should be guided by your experimental goals, with E. coli being optimal for basic characterization and structural studies, while yeast systems may better preserve native protein characteristics.

What purification strategies are most effective for recombinant SPBC1271.08c?

Effective purification of recombinant SPBC1271.08c typically employs the following strategies:

  • Affinity tag selection: Multiple tags have been successfully used:

    • His tag: For metal affinity chromatography

    • FLAG tag: For immunoaffinity purification

    • MBP tag: For improved solubility and affinity purification

    • GST tag: For glutathione-based affinity purification

  • Tag placement options: Both N-terminal and C-terminal tagging approaches are viable .

  • Post-purification processing: Options include:

    • Tag removal (if required for functional studies)

    • Protein renaturation (if expressed in inclusion bodies)

    • Endotoxin removal (for cell-based assays)

    • Sterilization filtration and lyophilization

Standard purification protocols typically achieve >80-95% purity depending on research requirements .

What potential functions can be inferred for SPBC1271.08c from genome-wide studies?

While SPBC1271.08c remains uncharacterized, several genome-wide studies provide clues to its potential functions:

  • Telomere-associated regulation: SPBC1271.08c was identified in studies of global expression changes resulting from loss of telomeric DNA in fission yeast, suggesting it may play a role in telomere-associated processes .

  • Cell wall dynamics: According to research on cell wall remodeling processes, SPBC1271.08c may be involved in cell wall-related functions, particularly in response to stress conditions .

  • Transcriptional responses: Expression data indicates potential involvement in stress response pathways, although specific stimuli affecting its expression are still being characterized .

It's worth noting that while these associations provide research directions, definitive functional characterization requires focused experiments targeting SPBC1271.08c specifically.

How does SPBC1271.08c compare to similar proteins in other yeast species?

The comparative analysis of SPBC1271.08c with proteins in other yeast species reveals:

  • S. cerevisiae homology: Unlike many neighboring genes in its chromosomal region, SPBC1271.08c does not have a clear homolog in Saccharomyces cerevisiae based on deletion phenotype comparisons .

  • Conservation pattern: This lack of obvious homology in S. cerevisiae is interesting given that many S. pombe proteins have recognizable counterparts in budding yeast, suggesting SPBC1271.08c may represent a specialized function in fission yeast biology .

  • Evolutionary implications: The absence of a clear homolog in S. cerevisiae might indicate that SPBC1271.08c evolved after the evolutionary divergence of these yeast lineages, or that its sequence has diverged beyond recognition while potentially maintaining functional similarity .

This evolutionary distinctiveness makes SPBC1271.08c particularly interesting for studies of fission yeast-specific cellular processes.

How can CRISPR-Cas9 be used to study SPBC1271.08c function in S. pombe?

CRISPR-Cas9 offers several strategic approaches for studying SPBC1271.08c function:

  • Knockout verification: While traditional deletion methods have established SPBC1271.08c as non-essential, CRISPR-Cas9 can create precise knockouts with reduced off-target effects for validation studies .

  • Conditional regulation:

    • Create an auxin-inducible degron tag fusion to enable rapid, reversible protein depletion

    • Implement a tetracycline-regulated promoter replacement to control expression levels

    • These approaches are valuable for studying proteins like SPBC1271.08c that may have redundant functions masked in complete knockout studies

  • Domain-specific modifications: Target specific protein domains to determine their functional importance without completely eliminating the protein.

  • Fluorescent tagging: Create C-terminal GFP or mCherry fusions to study protein localization under different conditions and during the cell cycle .

When designing guide RNAs, consider the gene's position relative to neighboring genes SPBC1271.07c and SPBC1271.09 to minimize interference with adjacent genomic regions .

What high-throughput approaches can be used to identify SPBC1271.08c interaction partners?

Several high-throughput approaches are suitable for identifying SPBC1271.08c interaction partners:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged SPBC1271.08c (His, FLAG, or TAP tag)

    • Isolate protein complexes under native conditions

    • Identify interacting partners via mass spectrometry

    • This approach has been successful with other S. pombe uncharacterized proteins

  • Yeast two-hybrid screening:

    • Use SPBC1271.08c as bait against an S. pombe cDNA library

    • Confirm interactions with reciprocal tests and co-immunoprecipitation

    • Consider using membrane yeast two-hybrid variants if membrane association is suspected

  • Proximity-dependent biotin identification (BioID):

    • Create a fusion of SPBC1271.08c with a promiscuous biotin ligase

    • Identify proteins in close proximity in living cells

    • Particularly valuable for identifying transient interactions

  • Genetic interaction mapping:

    • Cross SPBC1271.08c deletion strain with deletion library collection

    • Identify synthetic lethal or synthetic sick interactions

    • These patterns often reveal functional relationships and redundancy

When analyzing interaction data, prioritize hits appearing in multiple independent experimental approaches to reduce false positives.

How should researchers design experiments to characterize SPBC1271.08c expression patterns during the cell cycle?

To characterize SPBC1271.08c expression patterns during the cell cycle:

  • Synchronization methods selection:

    • Temperature-sensitive cdc25 mutant arrest-release

    • Lactose gradient centrifugation

    • Nitrogen starvation and release

    • Each method impacts cellular physiology differently, so confirming with multiple approaches is advisable

  • Time-course experimental design:

    • Collect samples at 10-15 minute intervals through at least one complete cell cycle

    • Monitor synchrony by measuring septation index microscopically

    • Extract RNA or protein at each timepoint for analysis

  • Expression analysis techniques:

    • Quantitative RT-PCR for mRNA levels

    • Western blotting with a tagged version of SPBC1271.08c

    • Single-cell fluorescence microscopy using a GFP-tagged construct

  • Data analysis framework:

    • Compare expression patterns with known cell cycle markers (cdc13, cdc25)

    • Cluster analysis with known cell cycle-regulated genes

    • Evaluate consistency across multiple synchronization methods

This multi-method approach minimizes artifacts from any single synchronization technique while providing robust temporal expression data.

What considerations are important when interpreting phenotypic data from SPBC1271.08c deletion strains?

When interpreting phenotypic data from SPBC1271.08c deletion strains, consider these critical factors:

  • Genetic background effects:

    • Different S. pombe laboratory strains (h+, h-, h90) may show strain-specific effects

    • Natural isolates have variable mating phenotypes and stress responses that could influence results

    • Always include appropriate isogenic controls

  • Environmental sensitivity:

    • Test deletion phenotypes under multiple conditions (temperature, pH, osmotic stress)

    • Minimal media vs. rich media may reveal condition-specific requirements

    • Caffeine resistance has been associated with heterochromatin changes in similar uncharacterized genes

  • Cell wall phenotype assessment:

    • Analyze β-glucan distribution using specific stains

    • Test sensitivity to cell wall-disrupting agents (calcofluor white, congo red)

    • Examine septum formation in dividing cells microscopically

  • Genetic interaction context:

    • Create double mutants with genes in related pathways

    • Synthetic genetic interactions may reveal redundant functions

    • Suppressor screens can identify compensatory pathways

The absence of obvious phenotypes in single-condition tests doesn't preclude important functions under specific circumstances or genetic backgrounds.

What strategies can improve solubility and stability of recombinant SPBC1271.08c?

To improve solubility and stability of recombinant SPBC1271.08c:

  • Expression optimization:

    • Test multiple growth temperatures (16°C, 25°C, 30°C, 37°C)

    • Vary induction conditions (inducer concentration, induction time)

    • Use specialized E. coli strains (Rosetta-GAMI) for rare codon optimization

  • Fusion tag selection:

    • MBP tag often provides superior solubility enhancement

    • SUMO tag can improve folding and stability

    • Compare multiple tags (His, GST, TrxA, NusA) for optimal results

  • Buffer composition optimization:

    • Screen buffer pH range (pH 6.0-8.0)

    • Test stabilizing additives (glycerol 5-20%, low concentrations of detergents)

    • Include protease inhibitors to prevent degradation

  • Refolding strategies if inclusion bodies form:

    • Gradual dilution refolding protocols

    • On-column refolding during purification

    • Molecular chaperone co-expression systems

Consider leveraging S. pombe-specific expression systems when E. coli expression proves challenging, as homologous expression often improves proper folding of species-specific proteins.

How can researchers design effective epitope-tagging strategies for SPBC1271.08c localization studies?

For effective epitope-tagging strategies in SPBC1271.08c localization studies:

  • Tag selection considerations:

    • Fluorescent proteins: GFP and mCherry are validated in S. pombe

    • Small epitope tags: HA, Myc, and FLAG tags for immunofluorescence

    • Enzymatic tags: SNAP, HALO, or BirA for specialized applications

  • Genomic integration approach:

    • C-terminal tagging is generally less disruptive to protein function

    • Use PCR-based integration with appropriate S. pombe selectable markers

    • Confirm single integration by Southern blot or PCR verification

    • Validate protein expression by Western blot

  • Functional validation requirements:

    • Confirm the tagged protein complementation in a deletion background

    • Compare growth rates and morphology to wild-type strains

    • Test known phenotypes to ensure tag doesn't interfere with function

  • Microscopy optimization:

    • Use methanol fixation for better preservation of S. pombe structures

    • Counterstain with DAPI for nuclear visualization

    • Include appropriate cellular markers (calcofluor for septum, rhodamine-phalloidin for actin)

While SPBC1271.08c's function remains uncharacterized, its localization pattern under different conditions may provide valuable functional insights.

How should conflicting experimental results regarding SPBC1271.08c function be reconciled?

When facing conflicting experimental results regarding SPBC1271.08c function:

  • Systematic validation approach:

    • Verify strain identity through PCR-based genotyping

    • Confirm results using independent methodologies

    • Test whether discrepancies are due to subtle differences in experimental conditions

    • Consider genetic background differences between laboratory strains

  • Conditional functionality assessment:

    • Evaluate whether conflicts reflect condition-specific functions

    • Test function under various stress conditions (oxidative, thermal, nutritional)

    • Examine cell cycle-specific requirements through synchronization experiments

    • Create conditional alleles to test acute vs. chronic loss effects

  • Redundancy investigation:

    • Identify potential paralogs or functionally redundant proteins

    • Create double or triple mutants to uncover masked phenotypes

    • Consider membership in larger protein families that might compensate for its loss

  • Integration with genomic data:

    • Compare with high-throughput datasets (transcriptomics, proteomics)

    • Look for patterns of co-regulation with genes of known function

    • Examine whether similar genes show consistent or contradictory patterns

Remember that uncharacterized proteins often have context-dependent functions that may appear contradictory when studied under different conditions.

What statistical approaches are most appropriate for analyzing SPBC1271.08c expression data across multiple conditions?

For statistically robust analysis of SPBC1271.08c expression data across multiple conditions:

  • Experimental design fundamentals:

    • Include sufficient biological replicates (minimum 3, preferably 5+)

    • Control for batch effects through appropriate experimental blocking

    • Include relevant reference/housekeeping genes for normalization

    • Consider time-course design for dynamic responses

  • Appropriate statistical tests:

    • For two-condition comparisons: t-test with multiple testing correction

    • For multi-condition comparisons: ANOVA followed by post-hoc tests

    • For time-course data: repeated measures ANOVA or time-series analysis

    • For complex designs: linear mixed-effects models incorporating random effects

  • Expression data normalization:

    • For RT-qPCR: geometric mean of multiple reference genes

    • For RNA-seq: DESeq2 or edgeR normalization methods

    • For microarray: quantile or RMA normalization

    • Always validate key findings using orthogonal techniques

  • Advanced analytical approaches:

    • Cluster analysis to identify co-regulated genes

    • Principal component analysis to identify major sources of variation

    • Gene set enrichment analysis to identify functional patterns

    • Network analysis to place SPBC1271.08c in functional contexts

When publishing results, include comprehensive statistical reporting and raw data availability to enable reanalysis and meta-analysis.

How can SPBC1271.08c be used as a model for studying uncharacterized proteins in other organisms?

SPBC1271.08c provides an excellent model for studying uncharacterized proteins because:

  • Systematic approach template:

    • Demonstrates step-wise characterization from viability assessment to functional studies

    • Provides framework for prioritizing experiments based on genomic context

    • Illustrates integration of high-throughput data with targeted studies

    • Serves as a model for phenotypic analysis in the absence of obvious homologs

  • Technological workflow development:

    • Use to establish protocols for recombinant expression optimization

    • Develop tagging strategies applicable to proteins of unknown function

    • Create standardized phenotypic screening batteries

    • Design modular computational analysis pipelines for integrating diverse data types

  • Evolutionary context investigation:

    • Study as an example of lineage-specific protein with potential specialized function

    • Examine selective pressures maintaining non-essential genes

    • Investigate potential horizontal gene transfer or rapid evolution scenarios

    • Compare with metagenomics data to identify environmental preferences

  • Educational value:

    • Use as a case study for training in protein function prediction

    • Demonstrate the process of hypothesis generation from limited data

    • Illustrate the importance of negative results in scientific progress

This approach creates a valuable research template applicable to the millions of uncharacterized proteins across all domains of life.

What role might SPBC1271.08c play in understanding S. pombe cell wall dynamics under stress conditions?

SPBC1271.08c may provide key insights into S. pombe cell wall stress responses:

  • Cell wall remodeling integration:

    • Evidence suggests SPBC1271.08c may be involved in cell wall remodeling processes

    • Its viability in deletion studies indicates a potential specialized role under stress rather than core structural function

    • May function in coordination with known stress-responsive cell wall enzymes

  • Research design approach:

    • Create reporter strains monitoring SPBC1271.08c expression under cell wall stressors

    • Test sensitivity of deletion strains to osmotic, mechanical, and chemical stresses

    • Analyze genetic interactions with known cell wall integrity pathway components

    • Perform detailed microscopic analysis of cell wall architecture in mutants

  • Global stress response context:

    • Examine coordination with telomere-associated stress responses

    • Investigate potential role in cellular aging processes

    • Evaluate contribution to environmental adaptation mechanisms

    • Analyze transcriptional regulation by stress-responsive transcription factors

  • Biotechnological applications:

    • Potential application in engineering stress-resistant yeast strains

    • Development of biosensors for environmental monitoring

    • Identification of novel targets for antifungal development

    • Understanding fundamental mechanisms of eukaryotic stress adaptation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.