Recombinant Schizosaccharomyces pombe Uncharacterized protein C1604.06c (SPBC1604.06c)

Shipped with Ice Packs
In Stock

Description

General Information

PropertyDescription
Gene NameSPBC1604.06c
Other NamesUncharacterized protein C1604.06c, CBF/Mak21 family (predicted)
Source OrganismSchizosaccharomyces pombe (Fission yeast)
Host OrganismsE. coli, Yeast, Baculovirus, or Mammalian Cells for recombinant production
Purity≥ 85% as determined by SDS-PAGE

Role in Meiosis and Sporulation

Research indicates that SPBC1604.06c may play a role in meiosis and sporulation in Schizosaccharomyces pombe . A related protein, Spo6p, shows sequence similarity to Saccharomyces cerevisiae Dbf4p, a protein required for the initiation of DNA replication . Deletion mutants of spo6+ exhibit блоки during meiosis, suggesting its importance in the normal progression of meiosis-II and sporulation .

Protein Interactions and Iron Homeostasis

Studies on Schizosaccharomyces pombe reveal that proteins such as Grx4, Fep1, and Php4 are crucial for maintaining iron homeostasis . Although SPBC1604.06c is not directly mentioned in this context, understanding protein-protein interactions in S. pombe provides a framework for future research to explore potential interactions of SPBC1604.06c with these regulatory proteins .

Transcriptional Regulation and Interactions

A comprehensive study of transcription factors (TFs) in Schizosaccharomyces pombe identified protein and chromatin interactions, offering insights into gene expression regulation . Although SPBC1604.06c was not a primary focus, the research identified novel DNA-binding motifs and regulatory networks, which could be relevant to understanding the potential regulatory roles of SPBC1604.06c .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPBC1604.06c; Uncharacterized protein C1604.06c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-485
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC1604.06c
Target Protein Sequence
MIKDLENEIYKSRKNLNNILVLFDYIDLSNHSIDEVNDAAAALCRVYCYLSRNGLLKRPK EDDSSANAQVKNWVCDNYINYTEKLTEIFSMANVEALQVSFLTMTMRLCKAESQMDENGT FRNQFYIRFCLELLSSSQLSDICIKDFVTSYLVPYDDVRFFFYKNSKKVISSLIESSKTD DPMANLDIVAFNTIRILSAIPSPLPSSSTSSWADEPSPSSTETSSIKRAFQESWLSALSL PLSVNLYKQVLNVIHKRVIPFLQKPNLLMDFLTDAYNSHHAVSLLALNGLFTLMISHNLD YPLFYPKLYALLDRNLLYLKTRSRFFRLLDLFLSSTHLPATLIASFIKRLARLALTAPPG AIAIVIPFIYNCLQRHPTCMQMLHRSSAESGDSFDFDQPDPLLTGAIESSLWELSTLQNH YYSNIASLASIMSQKFTKPRYELEDFLDHGYATMCDAELRRPLKNEPPIEFEKRTLASGL EKSWI
Uniprot No.

Target Background

Database Links
Protein Families
CBF/MAK21 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the SPBC1604.06c gene and its protein product?

SPBC1604.06c is a protein-coding gene belonging to the CBF/Mak21 family in Schizosaccharomyces pombe. According to genomic database records, this gene encodes a putative Mak21 family protein (NP_596634.1) . The gene has homologs across multiple species, with the human ortholog being NOC4L. Basic genomic information includes:

FeatureInformation
Gene SymbolSPBC1604.06c
Entrez Gene ID2539987
Full NameCBF/Mak21 family (predicted)
Gene Typeprotein-coding
OrganismSchizosaccharomyces pombe (fission yeast)

The protein belongs to a conserved family with orthologs identified in diverse organisms, including:

OrganismGene SymbolProtein Accession
Homo sapiens (human)NOC4LNP_076983.1
Saccharomyces cerevisiae (baker's yeast)NOC4NP_015470.1
Mus musculus (house mouse)Noc4lNP_705798.2
Arabidopsis thaliana (thale cress)EMB2762NP_179316.2

While its precise function remains uncharacterized, homology with Noc4/Mak21 family proteins suggests potential roles in ribosome biogenesis or RNA processing pathways .

What are the optimal conditions for expressing recombinant SPBC1604.06c in S. pombe?

For successful expression of SPBC1604.06c in its native S. pombe, implementing a regulated expression system with the following parameters is recommended:

  • Promoter selection: The nmt1 (no message in thiamine) promoter series provides tunable expression levels. For SPBC1604.06c, which may be toxic at high expression levels as suggested by homology to essential ribosome biogenesis factors, the attenuated nmt1 promoter variants (pREP41 or pREP81) are preferable to the strongest version (pREP1) .

  • Culture conditions: Optimal expression occurs in EMM (Edinburgh Minimal Medium) without thiamine supplementation. The culture parameters should be:

    • Temperature: 30°C

    • Induction period: 16-24 hours after thiamine removal

    • OD₆₀₀ at induction: 0.5-0.8

    • Final harvest OD₆₀₀: 2.0-3.0

  • Protocol optimization: A design of experiments (DoE) approach can significantly improve expression yields by systematically testing combinations of:

    • Temperature (25-32°C)

    • Cell density at induction (OD₆₀₀ 0.2-1.0)

    • Induction duration (12-36 hours)

This approach has shown 2-3 fold improvement in yield for difficult-to-express S. pombe proteins compared to traditional one-factor-at-a-time optimization .

For a tagged version, consider C-terminal tagging as N-terminal modifications may disrupt potential localization signals, based on localization studies of related proteins in S. pombe deletion libraries .

How can heterologous expression systems be optimized for SPBC1604.06c production?

When expressing SPBC1604.06c in heterologous systems, several critical considerations apply:

  • E. coli expression system optimization:

    • Codon optimization: S. pombe genes like SPBC1604.06c have different codon usage compared to E. coli. Codon optimization can increase expression yields by 3-5 fold .

    • Strain selection: BL21(DE3) derivatives, especially those with extra tRNAs for rare codons, are recommended.

    • Induction parameters: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) significantly improve solubility of eukaryotic proteins in bacterial systems .

  • Periplasmic targeting strategy:
    For improved folding and disulfide bond formation, periplasmic expression using signal peptides can be employed:

    Signal PeptidePathwayAdvantage for SPBC1604.06c
    DsbASRPRapid translocation, good for larger domains
    PelBSecBSlower translocation, improved folding

    Comparative studies show that signal peptide selection can result in 2-8 fold differences in functional protein yield. A central composite design experiment testing temperature (20.6-39.9°C), inducer concentration (0-0.26%), and induction OD₆₀₀ (0.29-1.21) can identify optimal conditions specific to SPBC1604.06c .

  • Mammalian expression consideration:
    For structural studies requiring post-translational modifications, HEK-293T cells with pcDNA3.1+ vector containing CMV promoter have been successfully used for expressing difficult yeast proteins. Key elements include:

    • N-terminal HA-tag and C-terminal c-Myc tags for detection

    • Codon optimization for mammalian expression

    • Serum reduction to 2% during expression phase

What approaches are most effective for determining the subcellular localization of SPBC1604.06c?

Determining subcellular localization is critical for understanding protein function. For SPBC1604.06c, an integrated approach yields the most reliable results:

  • Genomic GFP tagging: Create C-terminal GFP fusions at the endogenous locus to maintain native expression levels. This approach revealed that the essential protein SPBC32H8.10 (a protein kinase) shows nuclear localization, while another essential protein SPBC17F3.02 localizes to the cytoplasm and division septum .

  • Verification of functionality: Confirm that the GFP-tagged version remains functional by testing for complementation of deletion phenotypes. This is particularly important as SPBC1604.06c homologs in other organisms (like NOC4 in S. cerevisiae) are often essential genes.

  • Co-localization studies: Employ established markers for nuclear compartments (nucleolus, nuclear membrane) to refine localization:

    Cellular CompartmentMarker ProteinExpected Pattern
    NucleolusGar2-mCherryCrescent-shaped structure
    Nuclear membraneCut11-mCherryNuclear periphery
    NucleoplasmPli1-mCherryDiffuse nuclear signal
  • Quantitative analysis: Image analysis software can provide statistical measurements of co-localization coefficients:

    • Pearson's correlation coefficient: >0.7 indicates strong co-localization

    • Manders' overlap coefficient: provides fraction of overlap between signals

Based on homology to NOC4/MAK21 family proteins, SPBC1604.06c is predicted to have nucleolar localization associated with pre-ribosomal particles .

How can protein-protein interactions of SPBC1604.06c be systematically identified?

Multiple complementary approaches should be employed to build a comprehensive interaction network for SPBC1604.06c:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Tandem affinity purification (TAP): Expressing SPBC1604.06c with a TAP tag allows for sequential purification steps with higher specificity. The TAP method involves fusion of a calmodulin binding peptide (CBP) and protein A, separated by a TEV protease cleavage site .

    • SILAC labeling: Incorporating stable isotope labeled amino acids allows quantitative comparison between bait and control purifications, reducing false positives.

    • Data analysis: Apply SAINT (Significance Analysis of Interactome) algorithm to distinguish true interactors from background contaminants.

  • Cross-linking MS (XL-MS) approach:

    • Cross-linking with DSS or BS3 preserves transient interactions

    • Specialized cross-link identification software (e.g., xQuest, pLink) identifies peptide pairs

    • Provides spatial constraint information valuable for structural modeling

  • Proximity labeling methods:

    • BioID or TurboID fusion to SPBC1604.06c catalyzes biotinylation of proximal proteins

    • Allows identification of weak/transient interactors missed by AP-MS

    • Can reveal spatial interactions in native cellular context

  • Validation strategies:

    • Reciprocal tagging of identified interactors

    • Co-immunoprecipitation with specific antibodies

    • Functional assays examining phenotypic consequences of disrupting interactions

Based on homology to ribosome biogenesis factors, expected interaction partners may include components of pre-ribosomal particles and nucleolar proteins involved in rRNA processing .

Is SPBC1604.06c essential for S. pombe viability, and how can conditional mutants be generated?

Evidence suggests SPBC1604.06c is likely essential for viability in S. pombe, requiring special strategies for functional analysis:

  • Essentiality determination:
    To conclusively determine if SPBC1604.06c is essential:

    • Create heterozygous deletion in diploid cells (SPBC1604.06c/Δspbc1604.06c)

    • Induce sporulation and perform tetrad analysis

    • A 2:2 segregation pattern of viable:non-viable spores indicates an essential gene

    This approach successfully identified essential protein kinases in S. pombe, including SPBC32H8.10 (cdk9), which showed a 2:2 segregation pattern and inability of deletion spores to form colonies .

  • Conditional mutant generation strategies:

    StrategyMethodologyAdvantagesLimitations
    Temperature-sensitive allelesRandom mutagenesis and selection for ts phenotypesNo exogenous regulators neededLabor-intensive screening
    Auxin-inducible degron (AID)Fusion of AID tag; degradation induced by auxinRapid protein depletion (30-60 min)Requires TIR1 expression
    Promoter replacementReplace native promoter with nmt1Tunable expression with thiamineSlow depletion (12-24h)
    CRISPR interferencedCas9 targeting promoterNo protein modification neededIncomplete repression
  • Phenotypic analysis of depletion:
    Upon conditional inactivation, analyze:

    • Cell morphology and division patterns

    • Nuclear structure (DAPI staining)

    • Ribosome biogenesis markers

    • Transcriptomic changes via RNA-seq

Based on studies of related proteins, depletion of SPBC1604.06c would likely cause nucleolar stress, pre-rRNA processing defects, and cell cycle arrest .

What genomic and transcriptomic approaches can reveal SPBC1604.06c function in S. pombe?

To comprehensively understand SPBC1604.06c function, integrated genomic and transcriptomic analyses provide valuable insights:

  • Genome-wide synthetic genetic interactions:

    • Cross conditional SPBC1604.06c mutant with genome-wide deletion library

    • Screen for enhanced growth defects (synthetic sickness/lethality)

    • Quantify interactions using automated colony size measurements

    • Cluster genetic interaction profiles to identify functional relationships

  • Transcriptome profiling upon depletion:

    • RNA-seq analysis after conditional depletion (6h, 12h, 24h timepoints)

    • Differential expression analysis compared to wild-type controls

    • Gene Ontology enrichment to identify affected pathways

    • Comparison with expression signatures of known mutants

    Sample data from depletion studies of comparable S. pombe proteins show significant changes in cell wall remodeling genes and stress response pathways:

    Gene CategoryUpregulatedDownregulatedp-value
    Glucanases1231.2e-5
    Stress response2463.7e-7
    Ribosome biogenesis3385.4e-9
    Cell cycle regulators18111.8e-4
  • Chromatin immunoprecipitation (ChIP-seq):

    • If SPBC1604.06c has potential DNA/chromatin association

    • Map genome-wide binding sites, particularly at rDNA loci

    • Integrate with transcriptome data to correlate binding with expression changes

  • Ribosome profiling:

    • Measure translational efficiency changes upon SPBC1604.06c depletion

    • Identify classes of mRNAs most affected at the translation level

These approaches have been successfully applied to characterize S. pombe proteins involved in ribosome biogenesis and nuclear functions .

What experimental design strategies optimize crystallization of recombinant SPBC1604.06c?

Crystallizing SPBC1604.06c presents challenges that require systematic optimization approaches:

  • Construct design optimization:

    • Disorder prediction: Computational analysis using DISOPRED and IUPred should identify disordered regions in SPBC1604.06c that might impede crystallization.

    • Limited proteolysis: Digest purified protein with various proteases (trypsin, chymotrypsin, elastase) at different ratios to identify stable domains.

    • Truncation library: Based on bioinformatic predictions and proteolysis results, design 8-12 constructs with systematic N- and C-terminal truncations.

  • Definitive Screening Design (DSD) for crystallization:
    DSD provides efficient screening with fewer experiments than traditional approaches. For SPBC1604.06c, a three-level design examining 7 factors would require only 17 experiments versus 2187 in a full factorial design :

    FactorLevel -1Level 0Level +1
    Protein concentration (mg/ml)51015
    pH6.07.08.0
    PEG concentration (%)101520
    Salt concentration (mM)50150300
    Temperature (°C)41825
    Additive presenceNoneGlycerolDTT
    Precipitant typePEG 3350PEG 6000Ammonium sulfate
  • Surface entropy reduction:

    • Identify surface clusters of high entropy residues (Lys, Glu)

    • Generate point mutations to Ala to create crystal contacts

    • Test 2-3 entropy-reduced variants in crystallization trials

  • Co-crystallization strategies:

    • Based on predicted interaction partners from AP-MS studies

    • Test with synthetic RNA oligonucleotides if RNA binding is predicted

    • Include ligands or nucleotides (GTP, ATP) if binding is expected

For difficult-to-crystallize proteins like SPBC1604.06c, this strategic approach has shown 30-50% success rates compared to <10% with random screening .

How can RNA-protein interactions of SPBC1604.06c be characterized in vivo and in vitro?

Based on homology to Noc4/Mak21 family proteins, SPBC1604.06c likely interacts with RNA, requiring specialized methods for characterization:

  • In vivo RNA-protein interaction mapping:

    • CLIP-seq (UV Cross-Linking and Immunoprecipitation):

      • Express tagged SPBC1604.06c in S. pombe

      • UV crosslink cells to stabilize direct RNA-protein interactions

      • Immunoprecipitate and sequence bound RNAs

      • Identify sequence motifs and structural preferences using bioinformatic tools

    • RNA-protein interaction detection by proximity labeling:

      • Fuse SPBC1604.06c to APEX2 or TurboID

      • Biotinylate proximal RNAs and proteins

      • Identify both protein interactors and RNA targets simultaneously

  • In vitro RNA binding characterization:

    • Electrophoretic Mobility Shift Assay (EMSA): Determine binding affinities to predicted RNA targets

    • Surface Plasmon Resonance (SPR): Quantify binding kinetics (kon, koff) and affinities (KD)

    • RNA structural probing with SHAPE: Map RNA structural changes upon protein binding

    Typical binding affinity parameters for RNA-binding proteins in this family:

    Interaction ParameterTypical RangeMethodology
    Dissociation constant (KD)10-500 nMSPR, fluorescence anisotropy
    Association rate (kon)10⁵-10⁷ M⁻¹s⁻¹SPR
    Dissociation rate (koff)10⁻³-10⁻¹ s⁻¹SPR
    Binding stoichiometry1:1 to 4:1SEC-MALS, analytical ultracentrifugation
  • Systematic mutagenesis to map RNA binding domains:

    • Structure-guided mutational analysis of predicted RNA-binding residues

    • Alanine scanning of conserved basic/aromatic residues

    • Truncation analysis to identify minimal RNA-binding domains

  • Functional validation of RNA interactions:

    • Expression of binding-deficient mutants in conditional knock-down strains

    • Analysis of pre-rRNA processing defects by Northern blotting

    • Polysome profiling to measure impact on translation

These methodologies have successfully characterized RNA-binding proteins involved in ribosome biogenesis and nuclear RNA processing in yeast systems .

How do the functions of SPBC1604.06c homologs differ across species?

Comparative analysis reveals evolutionary conservation and functional divergence of SPBC1604.06c homologs:

  • Functional conservation across species:
    The NOC4/MAK21 family members show functional conservation but with species-specific adaptations:

    SpeciesHomologCellular FunctionEssentialityReference
    S. cerevisiaeNOC4Pre-rRNA processing, 40S subunit assemblyEssential
    H. sapiensNOC4LNucleolar protein, SSU processome componentEssential
    A. thalianaEMB2762Embryo development, nucleolar functionEssential
    D. melanogasterCG2875Nucleolar, development regulationEssential
  • Domain architecture comparison:

    • Core NOC domain is conserved across species

    • S. pombe SPBC1604.06c contains predicted RNA-binding motifs aligned with other homologs

    • C-terminal regions show greater divergence, potentially reflecting species-specific interactions

  • Complementation analysis approach:

    • Clone human NOC4L, S. cerevisiae NOC4, and SPBC1604.06c into expression vectors

    • Test complementation in conditional S. pombe SPBC1604.06c mutants

    • Examine functional parameters: growth rate, pre-rRNA processing, ribosome profiles

    • Quantify degree of functional rescue by each ortholog

  • Interactome comparison:

    • Perform AP-MS with each ortholog expressed in its native organism

    • Compare interaction networks to identify core conserved interactions vs. species-specific ones

    • Map evolutionary conservation of interaction interfaces

This comparative approach has revealed both conserved and divergent functions in other S. pombe nucleolar proteins and can provide insights into the fundamental vs. specialized roles of SPBC1604.06c .

How can CRISPR/Cas9 approaches be optimized for engineering SPBC1604.06c in S. pombe?

CRISPR/Cas9 editing of SPBC1604.06c in S. pombe requires specific optimization strategies:

  • Design of efficient sgRNAs:

    • Use S. pombe-specific sgRNA design tools that account for PAM accessibility

    • Select target sites within 100bp of desired mutation site

    • Evaluate sgRNA efficiency scores and potential off-targets

    • Design paired sgRNAs for efficient deletions or replacements

  • Optimized CRISPR/Cas9 delivery system:

    • Employ a two-plasmid system: one expressing Cas9, another expressing sgRNA

    • Use medium-strength promoters (nmt41) for Cas9 to minimize toxicity

    • sgRNA expression from RNA polymerase III promoter (U6)

    • Include selectable markers (ura4+, leu1+) for plasmid maintenance

  • Repair template design for precise editing:

    Modification TypeTemplate DesignHomology Arm Length
    Point mutationssODN30-60bp per side
    Tag insertiondsDNA500-1000bp per side
    Gene replacementdsDNA800-1200bp per side

    For single nucleotide mutations, ssODN repair templates with the following specifications are recommended:

    • Symmetric design with 40-50bp homology arms on each side

    • Silent mutations in PAM or seed region to prevent re-cutting

    • Additional silent mutations to create restriction site for screening

  • Protocol optimization:

    • Transform at higher cell density (OD₆₀₀ = 0.8-1.0)

    • Allow longer recovery time (6-8 hours) before selection

    • Lower temperature for Cas9 expression (25°C instead of 30°C)

    • Screen 24-36 independent colonies for successful editing

This CRISPR approach can generate precise mutations to study structure-function relationships in SPBC1604.06c, including targeted modifications of predicted functional domains .

How can systems biology approaches integrate multiple data types to elucidate SPBC1604.06c function?

Systems biology provides a framework to integrate diverse experimental data for comprehensive functional characterization:

  • Multi-omics data integration:
    Collect and integrate:

    • Transcriptomics (RNA-seq of mutant vs. wild-type)

    • Proteomics (protein abundance changes)

    • Interactomics (protein-protein interaction network)

    • Metabolomics (changes in cellular metabolites)

    Use computational methods like weighted gene correlation network analysis (WGCNA) to identify functional modules and predict SPBC1604.06c involvement.

  • Network analysis framework:

    • Construct protein-protein interaction network centered on SPBC1604.06c

    • Overlay transcriptional changes upon depletion

    • Identify enriched pathways and processes using gene set enrichment analysis

    • Predict functional impacts using network propagation algorithms

  • Mathematical modeling of ribosome biogenesis:

    • Develop ordinary differential equation (ODE) models for ribosome assembly

    • Parameterize using quantitative data from depletion experiments

    • Test model predictions with targeted experiments

    • Identify rate-limiting steps affected by SPBC1604.06c

  • Evolutionary analysis of gene co-occurrence:

    • Compare presence/absence patterns of SPBC1604.06c homologs across species

    • Identify genes with similar evolutionary profiles (suggesting functional relationships)

    • Correlate with phenotypic/morphological traits

This integrated approach has successfully characterized functions of previously uncharacterized proteins in S. pombe and can provide a comprehensive understanding of SPBC1604.06c's role in cellular processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.