Recombinant Schizosaccharomyces pombe Uncharacterized protein C1705.03c (SPAC1705.03c, SPAC1F2.01, SPAC23H4.19)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please specify this in your order for prioritized development.
Synonyms
ecm33; SPAC1705.03c; SPAC1F2.01; SPAC23H4.19; Cell wall protein ecm33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-421
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
ecm33
Target Protein Sequence
ASNCSSGPYNISAQGTLDELNSCTVLNGDLYISDAGNSGITTLTVNGIESVQGDVVVSDG QYLTSLSFPSLKNVSGAFNVNNMIRMNNLATPELTSVGSLNLAVLPNLQELQFNAGLSDS DSVVIDDTQLQAIDGISLDSVTTFQVTNNRYIQEITMEGLESAQNIQISANSKGVSVNFS KLSNVTTATFDGISNVFIGNLKSAAGNLYFSNTTLDNISVPYLTEIGQSFAVLYSPELTS LNFPNLTTVGGGFVINDTGLTSIDGFPVISEIGGGLVLLGNFSSIDMPDLSDVKGALTVE TKATNFTCPWSNDDSVIKGDDFTCQGSVATISATSSYDLSSTVSATSGSATSATGSATTT SYSSDSSASSSSSSSHESSAASNGFTAGALVLGSLLVAALAM
Uniprot No.

Target Background

Function
Involved in the negative feedback regulation of pmk1 cell integrity signaling and is linked to cellular calcium signaling.
Database Links
Protein Families
SPS2 family
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Secreted, cell wall.

Q&A

What are the best initial approaches to characterize an uncharacterized S. pombe protein like C1705.03c?

When approaching an uncharacterized protein, begin with a systematic workflow combining bioinformatic and experimental methods. First, conduct sequence analysis using homology searches to identify conserved domains and potential orthologs in other organisms. Follow with structural prediction using tools like AlphaFold2.

For experimental characterization, create tagged versions of C1705.03c using established methodologies as demonstrated in studies of other S. pombe proteins. Consider both C-terminal and N-terminal tagging approaches, as protein localization can be affected by tag position . Fluorescent protein fusions (GFP, mCherry) allow visualization of subcellular localization, while epitope tags (HA, FLAG) facilitate biochemical studies.

Next, create deletion or conditional mutants to assess phenotypic effects. For conditional expression, the nmt promoter series (nmt1, nmt41, or nmt81) provides different expression levels in the absence of thiamine . This approach allows you to determine if C1705.03c is essential and identify associated phenotypes in areas such as:

  • Cell growth and viability

  • Cell morphology

  • Cell cycle progression

  • Specialized structures (e.g., septum formation)

Characterization ApproachMethodsExpected OutcomeCommon Pitfalls
Sequence AnalysisBLAST, InterPro, HHpredPredicted domains, orthologsFalse positives from low-complexity regions
Subcellular LocalizationFluorescent tagging, immunofluorescenceOrganelle/structure associationTag interference with localization signals
Essentiality TestingGene deletion, conditional expressionViability assessmentCompensatory mechanisms masking phenotypes
Interaction PartnersCo-IP/MS, Y2H, BioIDProtein complexes, functional associationsNon-specific interactions, tag interference

How do I determine if C1705.03c is essential for S. pombe viability?

Determining essentiality requires a systematic genetic approach. Begin by attempting gene deletion in a diploid strain followed by tetrad dissection to observe if haploid deletion mutants are viable, similar to approaches used for other S. pombe proteins . Alternatively, implement a conditional expression system by placing C1705.03c under control of the thiamine-repressible nmt promoter series.

For more precise temporal control, consider the auxin-inducible degron (AID) system, which allows rapid protein depletion upon addition of auxin. This approach can distinguish between acute and chronic effects of protein loss.

When assessing viability, employ multiple quantitative methods:

  • Colony formation assays on solid media

  • Growth curves in liquid culture using optical density measurements

  • Viability staining with dyes like methylene blue or propidium iodide

  • Phloxine B, which stains dead cells in pink while leaving viable cells unstained

If the protein is essential, investigate the terminal phenotype by detailed microscopic analysis to determine the stage at which cell death or arrest occurs. This approach has been successfully used to characterize other essential S. pombe proteins like Sup11p .

What subcellular localization patterns might be expected for C1705.03c, and how should I investigate them?

Subcellular localization provides critical insights into protein function. Based on studies of other S. pombe proteins, common approaches include C- or N-terminal tagging with fluorescent proteins, with verification that tagging doesn't disrupt function.

When investigating localization:

  • Create strains with different tag positions (N-terminal vs C-terminal) as tag position can affect localization

  • Perform colocalization with known organelle markers

  • Examine localization throughout the cell cycle, as many S. pombe proteins show dynamic localization patterns

  • Consider immunogold electron microscopy for higher resolution localization

For biochemical confirmation, perform subcellular fractionation via sucrose density gradient centrifugation, similar to methods used for other S. pombe proteins . This allows separation of organelles and detection of the tagged protein in specific fractions by immunoblotting.

Many S. pombe proteins show distinct localization patterns based on their function:

  • Nucleus (transcription factors, chromatin regulators)

  • ER/Golgi (secretory pathway proteins)

  • Cell tips (polarity factors)

  • Division site/septum (cytokinesis proteins)

  • Cell wall/plasma membrane (cell wall synthesis/integrity proteins)

As observed with Sup11p, proteins involved in cell wall biosynthesis often localize to sites of active cell wall synthesis, including the septum during cell division .

How should I design experiments to identify potential functions of C1705.03c?

Designing experiments to elucidate protein function requires a systematic approach moving from broad phenotypic analysis to targeted functional studies. Begin with comprehensive phenotypic characterization of deletion or depletion mutants under various conditions:

  • Growth in different media (minimal vs. rich, different carbon sources)

  • Temperature sensitivity (25°C, 30°C, 36°C)

  • Cell wall stressors (calcofluor white, congo red, SDS)

  • Other stress conditions (oxidative, osmotic, genotoxic)

Document phenotypes quantitatively using growth assays and qualitatively through microscopic analysis, focusing on cell morphology, septum formation, and cell cycle progression.

For global analysis, perform transcriptomics (RNA-seq) comparing mutant to wild-type cells, as demonstrated in studies of Sup11p . This approach can identify affected pathways and processes when the protein is absent. Analysis should follow established frameworks:

Analysis TypePrimary MethodControlsOutcome
Phenotypic ScreeningCondition arraysWild-type, known mutantsSensitivity profile
Transcriptional AnalysisRNA-seqWild-type, biological replicatesDifferentially expressed genes
Genetic InteractionsSynthetic genetic arrayNon-interacting gene controlsGenetic network
LocalizationFluorescence microscopyUntagged strain, organelle markersSubcellular compartment

Based on initial findings, design targeted experiments for specific functions. For example, if transcriptomics implicates cell wall processes (as seen with Sup11p ), perform detailed cell wall composition analysis and test genetic interactions with known cell wall genes.

What controls should be included when analyzing phenotypes of C1705.03c mutants?

  • Wild-type parental strain grown under identical conditions

  • Complemented strain with wild-type gene reintroduced

  • For tagged proteins, both tagged wild-type and untagged mutant controls

  • For conditional systems (like nmt promoter constructs), both induced and uninduced conditions

For specialized phenotypes, include established mutants as positive controls. For example, when investigating potential cell wall functions, include strains with mutations in known cell wall synthesis genes like bgs1 or gas2 .

For high-throughput studies like transcriptomics, include:

  • Biological triplicates to assess reproducibility

  • Technical replicates to control for method variance

  • Time-course experiments to distinguish primary from secondary effects

Statistical analysis should employ appropriate tests with correction for multiple comparisons where applicable. For example, when analyzing transcriptomic data, use adjusted p-values (typically FDR or Bonferroni correction) to account for thousands of genes being tested simultaneously.

The experimental design approach should follow systematic research strategies as outlined in methodological frameworks for architectural research , ensuring proper alignment between research questions and methods.

How can I determine if C1705.03c is involved in cell wall integrity pathways?

To investigate potential cell wall functions of C1705.03c, implement a multi-faceted approach similar to studies of Sup11p and other cell wall proteins in S. pombe :

  • Sensitivity assays using cell wall-disrupting agents:

    • Calcofluor white (binds chitin and β-glucans)

    • Congo red (interferes with glucan assembly)

    • SDS (tests membrane/wall integrity)

    • Compare with wild-type and known cell wall mutants

  • Microscopic analysis using specific stains:

    • Calcofluor white for general cell wall visualization

    • Aniline blue for β-1,3-glucan

    • Examine septum formation, as abnormalities often indicate cell wall defects

  • Biochemical cell wall analysis:

    • Fractionate cell walls and analyze composition by HPLC

    • Determine β-1,3-glucan, α-glucan, and β-1,6-glucan content

    • Compare with profiles of known cell wall mutants like sup11

  • Genetic interaction studies:

    • Create double mutants with known cell wall genes

    • Test for synthetic lethality or suppression

    • Particularly focus on interactions with glucanases and glucan synthases

  • Transcriptomic analysis:

    • Identify changes in expression of cell wall genes

    • Compare with transcriptional signatures of known cell wall mutants

    • Look for changes in glucan modifying enzymes as observed in sup11 mutants

The involvement of proteins like Sup11p in β-1,6-glucan synthesis shows that uncharacterized proteins can play crucial roles in cell wall integrity pathways . A similar systematic approach to C1705.03c could reveal novel functions in cell wall biogenesis.

How should I analyze transcriptomic data from C1705.03c mutants?

Analyzing transcriptomic data from C1705.03c mutants requires a systematic approach to identify biological significance. Begin with rigorous quality control of raw sequencing data, including assessment of read quality, mapping rates, and sample correlation.

For differential expression analysis:

  • Use established software packages like DESeq2 or edgeR

  • Apply appropriate statistical thresholds (typically adjusted p-value < 0.05 and log2 fold change > 1)

  • Create visualization tools including volcano plots and heatmaps

For pathway and functional enrichment:

  • Categorize differentially expressed genes using Gene Ontology (GO) enrichment

  • Perform pathway analysis using KEGG or Reactome databases

  • For S. pombe specifically, use PomBase functional categories

When interpreting results, look for coherent patterns that suggest functional roles. For example, in Sup11p depletion studies, transcriptomic analysis revealed significant upregulation of cell wall glucan modifying enzymes, providing evidence for its role in cell wall integrity .

Analysis StepMethods/ToolsExpected OutputInterpretation Focus
Quality ControlFastQC, MultiQCQuality metrics, sample correlationData reliability assessment
Differential ExpressionDESeq2, edgeRDifferentially expressed genes with statisticsPrimary gene expression changes
Functional EnrichmentGO analysis, KEGG pathwayEnriched biological processes, pathwaysAffected cellular systems
Comparative AnalysisHeatmaps, PCAPatterns across conditions/mutantsContext within known responses

How can I resolve contradictory data when characterizing C1705.03c?

Resolving contradictory data is a common challenge when characterizing novel proteins. When faced with contradictions, apply a systematic approach:

  • Verify experimental system integrity:

    • Confirm strain genotypes by PCR

    • Verify tag functionality through expression checks

    • Ensure consistent growth conditions across experiments

  • Implement orthogonal methods:

    • If localization data conflicts between microscopy and biochemical fractionation, add a third method like proximity labeling

    • For functional contradictions, test under varied conditions (temperature, growth phase, stress)

    • Use different tagging strategies if tag interference is suspected

  • Consider context-dependent functions:

    • Many proteins have multiple functions in different cellular contexts

    • Test in different genetic backgrounds

    • Examine function throughout the cell cycle

  • Create separation-of-function mutants:

    • Target specific domains or residues

    • Test which functions are retained vs. lost

Experimental design approaches should follow a logical progression from strategies to tactics, as outlined in architectural research methods . This ensures that contradictions are addressed with appropriate methodological tools rather than ad hoc solutions.

Document all experimental conditions meticulously, as seemingly minor differences can significantly affect results with S. pombe. For example, media composition can dramatically impact protein function and expression, particularly for proteins involved in metabolic or stress response pathways.

How can I determine if phenotypes observed in C1705.03c mutants are direct or indirect effects?

Distinguishing direct from indirect effects is crucial for accurate functional characterization. Implement these strategies:

  • Use rapid protein depletion systems:

    • Auxin-inducible degron (AID) allows protein removal within minutes

    • Monitor immediate effects (likely direct) versus delayed effects (possibly indirect)

    • Compare with slower depletion methods like transcriptional repression

  • Perform time-course experiments:

    • Track the temporal order of phenotype appearance

    • Earlier phenotypes are more likely primary effects

    • Document phenotypic progression systematically

  • Create separation-of-function mutants:

    • Mutate specific domains or residues

    • Determine which functions are mechanistically linked to specific regions

    • Compare phenotypic profiles of different mutants

  • Use direct biochemical assays:

    • Test for enzymatic activities if predicted by sequence

    • Assess direct binding to potential partners or substrates

    • Purify the protein and test activity in defined systems

  • Employ nascent transcriptomics:

    • Use techniques like NET-seq to capture immediate transcriptional changes

    • Distinguishes primary transcriptional responses from secondary adaptation

This systematic approach follows experimental design principles that progress from broad strategies to specific tactics , allowing you to build a coherent understanding of C1705.03c function based on multi-layered evidence.

What approaches can reveal genetic interactions of C1705.03c with other S. pombe genes?

Genetic interactions provide crucial insights into functional relationships between genes. To systematically identify genetic interactions of C1705.03c:

  • Perform synthetic genetic array (SGA) analysis:

    • Cross your C1705.03c mutant with an ordered array of deletion mutants

    • Identify synthetic lethal, sick, or suppressive interactions

    • Quantify interaction strength using growth measurements

  • For targeted analysis, create double mutants with genes in suspected pathways:

    • For potential cell wall functions, test interactions with glucan synthases (bgs1-4) and glucanases (gas1-5)

    • For potential nuclear functions, similar to Nro1 , test interactions with nuclear transport machinery

    • Quantify genetic interactions using growth rate measurements and microscopic phenotyping

  • Perform dosage suppression screens:

    • Overexpress C1705.03c in other mutant backgrounds

    • Identify rescues of mutant phenotypes

    • Test if other genes can suppress C1705.03c mutant phenotypes when overexpressed

Genetic Interaction ApproachMethodologyInterpretationExample Finding
Synthetic LethalityDouble mutant creation, SGAParallel pathway or complex participationsup11+ interactions with glucanase family
Dosage SuppressionGene overexpressionDownstream component or shared functionMulticopy suppression patterns
Epistasis AnalysisPhenotype comparison in double mutantsPathway order determinationOrder of action in a pathway
Allele-specific InteractionsTesting specific mutationsDirect physical interactionDomain-specific functional relationships

Analysis of genetic interactions should incorporate quantitative metrics and statistical analysis to distinguish strong from weak interactions and true interactions from experimental noise.

What are the optimal approaches for studying protein-protein interactions of C1705.03c?

Protein-protein interactions reveal functional complexes and pathways. For C1705.03c, implement these complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Tag C1705.03c with epitope tags (HA, FLAG) or affinity tags (TAP, HBH)

    • Purify under native conditions to maintain interactions

    • Identify co-purifying proteins by mass spectrometry

    • Include appropriate controls (untagged strains, tag-only controls)

  • Proximity-dependent labeling:

    • Fuse C1705.03c to BioID or APEX2

    • Allow proximity-dependent biotinylation of nearby proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • Particularly useful for transient or weak interactions

  • Targeted validation approaches:

    • Co-immunoprecipitation with specific antibodies

    • Fluorescence microscopy co-localization

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

  • In vitro binding assays:

    • Express recombinant proteins or domains

    • Perform pull-down assays

    • Use surface plasmon resonance or isothermal titration calorimetry for quantitative binding parameters

When analyzing interaction data, distinguish true interactions from common contaminants using appropriate statistical methods and databases of known contaminants. Studies of other S. pombe proteins like Nro1 provide useful methodological templates .

How can structural biology approaches be applied to understand C1705.03c function?

Structural biology provides mechanistic insights into protein function. For C1705.03c, consider these approaches:

  • Predictive structural analysis:

    • Use AlphaFold2 to generate structural predictions

    • Identify potential functional domains and binding sites

    • Compare with structurally characterized proteins like Nro1, which revealed a surprising TPR fold

  • X-ray crystallography:

    • Express and purify recombinant C1705.03c

    • Screen crystallization conditions

    • Solve the structure by molecular replacement or experimental phasing

    • Similar to the approach used for Nro1, which identified unexpected structural features

  • Cryo-electron microscopy:

    • Particularly useful for larger complexes

    • Can capture different conformational states

    • May reveal interaction interfaces

  • Nuclear magnetic resonance (NMR):

    • Suitable for smaller domains

    • Provides dynamic information

    • Useful for mapping interaction surfaces

  • Structure-guided functional studies:

    • Design mutations based on structural information

    • Target conserved surface residues

    • Test effects on function and interactions

The structural characterization of Nro1 demonstrated how structural biology can reveal unexpected features - the protein adopted a TPR fold despite lack of sequence-based prediction, with specific conserved residues forming a binding pocket for ligands . Similar surprises might await in the structure of C1705.03c.

How can I optimize protein expression and detection of C1705.03c?

Optimizing expression and detection of uncharacterized proteins requires systematic troubleshooting:

  • For expression optimization:

    • Test different promoters (native, nmt1/41/81, adh1)

    • Optimize induction conditions for regulatable promoters

    • Consider codon optimization if sequence contains rare codons

    • Test both N- and C-terminal tags as terminal accessibility varies

  • For protein extraction:

    • Test different lysis methods (mechanical, enzymatic)

    • Optimize buffer conditions (pH, salt concentration, detergents)

    • For membrane proteins, use specialized detergents (DDM, digitonin)

    • Include protease inhibitors to prevent degradation

  • For detection optimization:

    • Try different tag types (HA, FLAG, myc, GFP)

    • Optimize antibody dilutions and incubation conditions

    • For Western blotting, test different blocking agents

    • For low abundance proteins, use concentration methods (TCA precipitation, immunoprecipitation)

IssuePotential SolutionsValidation Method
Low expressionTest stronger promoters, optimize inductionWestern blot quantification
Poor solubilityModify buffer conditions, add detergentsSoluble vs. insoluble fraction analysis
DegradationAdd protease inhibitors, express at lower temperatureTime-course stability analysis
Weak detectionTry different antibodies, enhance sensitivity with ECL+Signal-to-noise ratio comparison

When working with tagged proteins, always verify functionality by complementation testing - ensure the tagged protein rescues the phenotype of the deletion mutant, as demonstrated in studies of other S. pombe proteins .

How should I approach analysis of subtle phenotypes in C1705.03c mutants?

Detecting and analyzing subtle phenotypes requires enhanced sensitivity and statistical rigor:

  • Expand condition testing:

    • Test growth across a range of temperatures (20-36°C)

    • Vary media composition (carbon sources, nitrogen sources)

    • Apply subtle stress conditions (low concentrations of stressors)

    • Create environmental gradients rather than single conditions

  • Enhance detection sensitivity:

    • Use automated growth analysis in microplate readers

    • Implement high-content microscopy with automated image analysis

    • Perform flow cytometry for quantitative single-cell analysis

    • Use competition assays where mutant and wild-type compete directly

  • Increase statistical power:

    • Increase biological replicates (minimum 5-6)

    • Use appropriate statistical tests for small effect sizes

    • Implement power analysis to determine required sample sizes

    • Consider non-parametric methods if data doesn't meet normality assumptions

  • Apply molecular phenotyping:

    • Use RNA-seq for transcriptional profiling

    • Perform targeted proteomics for specific pathway components

    • Analyze specific metabolites if metabolic functions are suspected

    • Apply single-cell techniques to detect population heterogeneity

What analytical approaches help distinguish C1705.03c functions from other related proteins?

Distinguishing the specific functions of C1705.03c from related proteins requires comparative approaches:

  • Comparative phenotypic analysis:

    • Create a panel of mutants in related genes

    • Test all under identical conditions

    • Generate quantitative phenotypic profiles

    • Use clustering analysis to identify similarities and differences

  • Domain swapping experiments:

    • Identify functional domains through sequence analysis

    • Create chimeric proteins with domains from related proteins

    • Test which domains confer which functions

    • Identify unique vs. shared functional elements

  • Substrate specificity analysis:

    • For enzymatic functions, test activity against multiple substrates

    • Compare specificity profiles across related proteins

    • Identify unique substrates or reaction conditions

  • Differential interaction mapping:

    • Compare protein interaction networks between related proteins

    • Identify unique vs. shared interactors

    • Construct interaction network models

  • Evolutionary analysis:

    • Compare orthologs across species

    • Identify conserved vs. divergent features

    • Correlate with functional differences between species

This comparative approach is particularly important in S. pombe, which contains many gene families with partially redundant functions, as seen in the glucan synthase family (bgs1-4) and glucanosyltransferase family (gas1-5) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.