SPCC1795.12c is an uncharacterized protein encoded by the SPCC1795.12c gene in Schizosaccharomyces pombe (fission yeast), a model organism widely used to study eukaryotic cellular processes . The recombinant form is expressed in E. coli with an N-terminal 10xHis tag for purification . Key details include:
UniProt ID: O59776
Sequence: 112 amino acids (MYRPTTTSYSPVYTGNPLYDISASQSDPRQRIRKNVRFQTEVDEFPDFDDSDSDELQFEN RDPRKRIDPIKHMLLVQRLKRVSTSSRRLFIFTLSMFLIAFILLIAFVSFRD)
While direct functional studies on SPCC1795.12c are lacking, its homology to other S. pombe proteins suggests potential roles:
Transmembrane Activity: Structural features imply involvement in membrane-associated processes .
Regulatory Networks: Recent genome-wide studies of S. pombe transcription factors (TFs) highlight uncharacterized proteins as critical components of chromatin interaction networks . SPCC1795.12c may participate in TF-mediated gene regulation or protein complexes.
Post-Translational Modifications: Like other S. pombe proteins (e.g., YPT family GTPases ), SPCC1795.12c could undergo prenylation or methylation for localization or activity .
Functional Characterization: No experimental data on enzymatic activity, binding partners, or cellular localization exist.
Evolutionary Conservation: Homology to proteins in other species remains unexplored.
Integration with Omics Data: Integration into S. pombe interactome databases (e.g., TFexplorer ) could reveal regulatory roles.
KEGG: spo:SPCC1795.12c
SPCC1795.12c is classified as an uncharacterized protein in the fission yeast Schizosaccharomyces pombe with a full length of 112 amino acids. According to available databases, it has not yet been associated with specific biological pathways, functions, or protein interactions . This protein represents an opportunity for novel discovery using modern molecular biology techniques. While its small size suggests it may function as part of a larger complex or have a regulatory role, its specific cellular functions remain to be elucidated through experimental approaches.
Recombinant SPCC1795.12c can be expressed using E. coli expression systems with a histidine tag for purification, as indicated by commercially available preparations . For optimal expression, consider the following protocol:
Clone the SPCC1795.12c coding sequence into an expression vector with a histidine tag
Transform the construct into an E. coli expression strain (e.g., BL21(DE3))
Induce protein expression at optimal temperature (typically 16-30°C)
Lyse cells using appropriate buffer systems that maintain protein stability
Purify using nickel affinity chromatography followed by size exclusion chromatography
For S. pombe proteins, codon optimization may significantly improve expression yields in E. coli systems. After purification, verify protein identity through mass spectrometry and Western blotting with anti-histidine antibodies.
Initial characterization should employ a multi-faceted approach:
Bioinformatic analysis to identify conserved domains and potential homologs
Subcellular localization studies using fluorescent protein tags or immunofluorescence
Gene deletion studies to observe phenotypic effects in various growth conditions
Protein interaction studies using techniques such as yeast two-hybrid or affinity purification coupled with mass spectrometry
Gene expression analysis across different growth conditions and cell cycle stages
Given SPCC1795.12c's small size (112 amino acids) , consider whether C-terminal or N-terminal tagging would be less likely to disrupt function. When analyzing deletion phenotypes, examine cells microscopically using differential interference contrast and fluorescence microscopy to detect subtle morphological changes .
While there is no current evidence that SPCC1795.12c functions as a transcription factor, ChIP-seq could determine if it interacts with chromatin:
Generate strains expressing epitope-tagged SPCC1795.12c under its native promoter
Perform chromatin immunoprecipitation following established S. pombe protocols
Prepare and sequence immunoprecipitated DNA fragments
Analyze data using peak calling algorithms, retaining peaks with at least 1.75-fold enrichment in at least two samples
Perform motif discovery analysis to identify potential DNA binding sequences
If SPCC1795.12c binds specific DNA sequences, consider complementary approaches such as 6-mer enrichment analysis, which has successfully identified binding preferences for other S. pombe proteins . Compare identified motifs with known transcription factor binding sites to place findings in context.
To comprehensively map the interactome of SPCC1795.12c:
Perform affinity purification of tagged SPCC1795.12c followed by mass spectrometry
Conduct yeast two-hybrid screening against an S. pombe genomic library
Implement genetic interaction screens by crossing SPCC1795.12c deletion strains with deletion libraries
Use Yeast Augmented Network Analysis (YANA) to examine conserved genetic interactions
For genetic interaction screens, results can be quantified using software like ScreenMill to identify statistically significant growth defects (synthetic lethal) or growth enhancement (synthetic suppressor) . The pattern of genetic interactions often reveals the biological process in which an uncharacterized protein functions.
The table below summarizes different interaction analysis approaches:
Temperature sensitivity assays can reveal potential roles in essential cellular processes:
Generate temperature-sensitive alleles through random or site-directed mutagenesis
Transform constructs into an SPCC1795.12c deletion background
Test growth at permissive (25°C) and restrictive temperatures (35.5-36.5°C)
Incorporate phloxin B into media, which stains dead cells for easy visualization
Analyze cellular phenotypes microscopically at the restrictive temperature
For viable temperature-sensitive mutants, calculate generation times using the equation: T = log(2)/(log(y/x)/(t2-t1)), where T is generation time, y is cells/ml at time t2, and x is cells/ml at time t1 . This approach can reveal if SPCC1795.12c is involved in essential processes such as cell division or morphogenesis.
To characterize the expression and regulation of SPCC1795.12c:
Perform RNA-seq comparing wild-type strains to SPCC1795.12c deletion mutants
Conduct time-course experiments during cell cycle progression and stress responses
Analyze promoter elements to identify potential regulatory motifs
Integrate findings with existing periodic gene expression data to determine if SPCC1795.12c shows cell cycle-regulated expression
When preparing RNA from S. pombe, typical protocols yield approximately 100μg from standard cultures, with 10μg needed for each Northern blot analysis . For investigating cell cycle-regulated expression, synchronize cultures using methods like centrifugal elutriation or block-and-release with temperature-sensitive mutants .
To investigate potential regulatory functions:
Perform RNA-seq comparing transcriptomes of wild-type and SPCC1795.12c deletion strains
If nuclear localization is observed, conduct ChIP-seq following protocols similar to comprehensive S. pombe transcription factor studies
Examine genetic interactions with known transcriptional regulators such as MBF, ace2p, or sep1p
If ChIP-seq data suggests DNA association, identify potential binding motifs through techniques like 6-mer enrichment analysis
Analyze the distribution of any binding sites relative to transcriptional start sites and correlate with gene expression data. For proteins without classical DNA-binding domains, consider roles in chromatin remodeling or as transcription cofactors.
For precise genetic manipulation of SPCC1795.12c:
Design guide RNAs with minimal off-target effects using S. pombe-specific prediction tools
Prepare repair templates containing homology arms flanking the target site
Optimize transformation protocols specifically for S. pombe
Screen transformants using PCR, restriction digestion, or sequencing
Verify modified strains for expression or deletion as appropriate
For tagging SPCC1795.12c, consider its small size (112 amino acids) and use compact epitope tags or fluorescent proteins with flexible linkers to minimize functional disruption. Transformation efficiency can be improved by synchronizing cells and performing transformations during S phase.
Auxotrophic markers provide powerful selection tools for genetic studies:
Select appropriate markers (adenine, glutamic acid, histidine, leucine, lysine, or uracil) based on strain background
Design gene deletion or tagging constructs with the selected marker flanked by SPCC1795.12c homology regions
Transform constructs into auxotrophic S. pombe strains
Select transformants on minimal media lacking the nutrient corresponding to the marker
Confirm correct integration by PCR or sequencing
Typical supplement concentrations are 225mg/L, though 75mg/L is sufficient except for leucine auxotrophs, which require higher concentrations for optimal growth . Testing for auxotrophy requires replica plating single colonies from YES media to minimal media with and without the appropriate supplement .
To investigate post-translational modifications (PTMs):
Perform mass spectrometry analysis of purified SPCC1795.12c to identify modifications
Conduct Western blotting with modification-specific antibodies
Compare PTM profiles under different cellular conditions (e.g., cell cycle stages, stress responses)
Create mutant versions where predicted modification sites are altered
Assess the functional impact of these mutations through phenotypic analysis
For small proteins like SPCC1795.12c (112 amino acids) , even a single PTM could significantly impact function. Analysis under different conditions is crucial as PTMs are often dynamically regulated.
For optimal visualization of SPCC1795.12c:
Generate C- or N-terminal fluorescent protein fusions under native promoter control
Use confocal or spinning disk microscopy for high-resolution imaging
Implement time-lapse microscopy to track protein dynamics during the cell cycle
Employ photobleaching techniques (FRAP) to measure protein mobility
Perform co-localization studies with known cellular markers
For S. pombe specifically, consider the rod-shaped morphology, potential autofluorescence, and optimal growth conditions (29-32°C for wild-type strains) . Differential interference contrast (DIC) microscopy can provide complementary information about cell morphology and division stages .
Multiple complementary techniques can reveal structural insights:
NMR spectroscopy would be particularly advantageous for this small protein, potentially revealing dynamic properties and interaction surfaces. Structural studies should be complemented by biochemical assays to validate functions suggested by the structure.
Evolutionary analysis provides crucial functional insights:
Perform BLAST searches against diverse fungal and eukaryotic genomes
Create multiple sequence alignments of identified homologs
Construct phylogenetic trees using maximum likelihood methods
Analyze selection pressure using dN/dS ratios to identify conserved functional domains
Integrate orthology data from specialized databases like PomBase, OrthoMCL, InParanoid8, and Homologene
For uncharacterized proteins, identifying even distant homologs with known functions can provide crucial functional hints. Analysis of synteny (conservation of genomic context) across species can reveal functional relationships that sequence comparison alone might miss.
For comprehensive functional characterization:
Create a query strain with SPCC1795.12c deleted or conditionally expressed
Systematically cross this strain with an ordered array of deletion strains
Analyze resulting double mutants for synthetic lethality (SL) or synthetic suppression (SS)
Quantify colony sizes using software like ScreenMill
Normalize data and identify statistically significant interactions (P≤0.05)
Results can be organized into interaction networks to identify functional relationships. The table below shows an example format for organizing significant genetic interactions:
| Interacting Gene | Systematic ID | Interaction Type | P-value | Known Function |
|---|---|---|---|---|
| Gene 1 | SPBC1734.08 | Synthetic Lethal | <0.01 | DNA repair |
| Gene 2 | SPAC23D3.09 | Synthetic Suppressor | <0.05 | Cell cycle |
| Gene 3 | SPAC17A5.11 | Synthetic Lethal | <0.01 | Stress response |
This approach is particularly valuable for uncharacterized proteins, as the pattern of genetic interactions often reveals the biological process in which the protein functions .
Modern bioinformatic prediction should include:
Sequence-based analysis using tools like InterProScan, SignalP, and TMHMM
Structure prediction using AlphaFold2 or RoseTTAFold
Function prediction using tools that integrate structural information
Protein-protein interaction prediction using interface prediction algorithms
Gene neighborhood analysis to identify functionally related genes
For small proteins like SPCC1795.12c (112 amino acids) , complete structure prediction is now feasible with high confidence. Analysis of predicted binding surfaces and electrostatic properties can suggest potential molecular functions that can guide experimental design.