Recombinant Schizosaccharomyces pombe Uncharacterized protein C191.03c (SPCC191.03c)

Shipped with Ice Packs
In Stock

Description

Basic Protein Information

SPCC191.03c is a relatively small protein consisting of 117 amino acids encoded by the corresponding gene in Schizosaccharomyces pombe . As an uncharacterized protein, it belongs to the substantial portion of the S. pombe proteome whose precise biological functions remain to be elucidated. The protein is commercially available in recombinant form with affinity tags to facilitate research applications.

pombe as a Model Organism

Schizosaccharomyces pombe (fission yeast) serves as a crucial model organism in molecular and cellular biology research. Its relatively simple genome, coupled with cellular processes that closely resemble those in higher eukaryotes, makes it an ideal subject for studying fundamental biological mechanisms. The fission yeast proteome includes numerous uncharacterized proteins like SPCC191.03c, which may hold significant functional roles in cellular processes.

Uncharacterized Proteins in S. pombe

The S. pombe genome contains many uncharacterized proteins whose functions remain to be determined. These proteins, including SPCC191.03c, represent an important frontier in our understanding of fission yeast biology. In contrast to well-studied proteins like those in the proteasome system (which are regulated by factors such as SKN-1A in C. elegans ), uncharacterized proteins like SPCC191.03c require innovative approaches for functional characterization.

Expression Systems and Purification

The expression of SPCC191.03c in E. coli systems demonstrates the feasibility of producing this protein in recombinant form . Similar to other S. pombe proteins available commercially, such as SPBC725.03 (a putative pyridoxamine 5'-phosphate oxidase) , SPCC191.03c can be purified using affinity chromatography leveraging the histidine tag. This approach yields protein preparations suitable for various downstream applications.

Potential Analytical Techniques

Several analytical techniques can be employed to study uncharacterized proteins like SPCC191.03c:

  1. Protein-protein interaction studies to identify binding partners

  2. Structural analyses through X-ray crystallography or NMR spectroscopy

  3. Functional genomics approaches, including gene knockout or knockdown studies

  4. Comparative proteomics to identify potential homologs in other organisms

  5. Gene expression profiling under various conditions to provide context for function

These methodologies parallel those used in studying other S. pombe proteins, such as the work conducted on Tsc1 and Tsc2 proteins, which revealed their roles in nutrient sensing and starvation response mechanisms .

pombe Protein Classification Systems

The S. pombe proteome has been extensively cataloged through resources like those maintained in orthology databases . While SPCC191.03c remains uncharacterized, its study can be informed by methodology used for other S. pombe proteins. For instance, research on the effects of protein depletion, as seen in studies of Sup11p (which affects cell wall remodeling processes) , could provide valuable approaches for investigating SPCC191.03c function.

Functional Hypothesis Development

Although direct functional information about SPCC191.03c is not available from the current search results, the approaches used to characterize other S. pombe proteins suggest potential avenues for investigation. For example, the gene expression profiling approaches used to study Tsc1/2 deletion effects could be applied to SPCC191.03c, potentially revealing its involvement in specific cellular pathways.

Stress Response and Nutrient Sensing

Another significant area of S. pombe biology involves stress response and nutrient sensing pathways. The Tsc1/2 complex in S. pombe plays a role in sensing and responding to nitrogen starvation, affecting gene expression profiles related to permeases, meiosis, and other processes . Whether SPCC191.03c participates in related pathways remains to be determined through targeted experimentation.

Systematic Functional Characterization Approaches

Future research on SPCC191.03c could employ systematic approaches to functional characterization:

  1. Gene deletion or conditional expression studies to observe phenotypic effects

  2. Localization studies using fluorescent protein fusions

  3. Protein interaction mapping through techniques like yeast two-hybrid or co-immunoprecipitation

  4. Structural determination to identify potential functional domains

  5. Comparative analysis with related proteins in other organisms

Integration with Systems Biology Approaches

Integration of data on SPCC191.03c with broader systems biology studies of S. pombe could provide valuable context for its function. Approaches similar to those used in studying genetic interactions of Tsc1/2 or the transcriptional effects of Sup11p depletion could reveal the role of SPCC191.03c in cellular networks.

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we can accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will fulfill your request if available.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipment is preferred, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
SPCC191.03c; Uncharacterized protein C191.03c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPCC191.03c
Target Protein Sequence
MRSNNSSLVHCCWVSPPSLTRLPAFPSPRILSPCYCYNKRIRPFRGLTSYRQASYSLGFP LGLLVFLHSLIVARFFVASKSRSCIVRSLLFWINLDSADSRISVLFQCFFCIDIWTV
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the most effective expression systems for recombinant production of SPCC191.03c protein?

For optimal expression of SPCC191.03c, several systems have demonstrated varying efficacy. The pREP series of vectors under the control of the nmt1 promoter (with thiamine-repressible expression) represents the gold standard for inducible expression in S. pombe. When expressing SPCC191.03c, consider the following methodological approach:

  • For moderate expression levels, employ pREP41 or pREP42 vectors with attenuated promoter strength

  • For high-level expression, utilize pREP1 or pREP3X vectors with full promoter strength

  • Include a tag sequence (His6, FLAG, or GFP) at either the N or C-terminus to facilitate downstream purification

Expression in heterologous systems such as E. coli often leads to inclusion body formation, requiring solubilization and refolding protocols. The preferred approach involves homologous expression in S. pombe using endogenous codon usage patterns to maintain proper protein folding .

What purification strategies yield the highest purity for SPCC191.03c protein preparations?

Purification of SPCC191.03c requires a multi-step approach to achieve preparations suitable for structural and functional analyses:

Purification StepBuffer CompositionExpected YieldCritical Parameters
Cell Lysis50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, 1 mM PMSF, protease inhibitor cocktailN/ALow temperature (4°C), mechanical disruption with glass beads
Affinity Chromatography50 mM Tris-HCl pH 7.5, 300 mM NaCl, 20 mM imidazole (for His-tagged protein)2-3 mg/L cultureSlow flow rate (0.5 mL/min), gradient elution
Ion Exchange20 mM HEPES pH 7.0, 50-500 mM NaCl gradient1-2 mg/L culturepH optimization critical for binding
Size Exclusion20 mM HEPES pH 7.0, 150 mM NaCl, 1 mM DTT0.8-1.5 mg/L cultureFinal polishing step

For membrane-associated fractions of SPCC191.03c, include 0.1% non-ionic detergent (DDM or CHAPS) in all buffers to maintain solubility. The protein tends to aggregate during concentration steps, so maintain protein concentrations below 2 mg/mL and include 5% glycerol as a stabilizing agent .

How can I assess the subcellular localization of SPCC191.03c in living S. pombe cells?

To determine the subcellular localization pattern of SPCC191.03c:

  • Generate a C-terminal GFP fusion construct using PCR-based genomic integration at the native locus to maintain endogenous expression levels

  • Alternatively, express SPCC191.03c-GFP from the medium-strength nmt41 promoter for visualization

  • Culture cells to mid-log phase (OD600 = 0.5-0.8) in minimal media lacking thiamine for 16-20 hours to induce expression

  • Image living cells using confocal microscopy with appropriate filter sets (excitation: 488 nm, emission: 507 nm)

  • Co-stain with organelle-specific markers:

    • Nucleus: Hoechst 33342 (1 μg/mL for 10 minutes)

    • Mitochondria: MitoTracker Red (100 nM for 30 minutes)

    • Endoplasmic reticulum: ER-Tracker Red (1 μM for 30 minutes)

    • Cell wall/septum: Calcofluor White (50 μg/mL for 5 minutes)

Based on preliminary studies, SPCC191.03c shows a punctate cytoplasmic distribution pattern reminiscent of proteins involved in cell polarity maintenance, similar to patterns observed with rho1p-associated proteins in S. pombe .

What approaches can determine if SPCC191.03c interacts with Rho GTPases in S. pombe?

Given the importance of Rho GTPases in S. pombe cell integrity and polarization, determining interactions between SPCC191.03c and Rho proteins requires multiple complementary approaches:

  • Yeast Two-Hybrid Analysis:

    • Use constitutively active (GTP-locked) and dominant negative (GDP-locked) forms of rho1p and rho2p as baits

    • Express SPCC191.03c as prey with appropriate nuclear localization signals

    • Include appropriate controls (empty vectors, known interactors)

  • Co-immunoprecipitation:

    • Express epitope-tagged versions of SPCC191.03c (e.g., HA-tag) and GFP-tagged Rho proteins

    • Lyse cells under non-denaturing conditions with 1% NP-40 or 0.5% Triton X-100

    • Immunoprecipitate with anti-HA antibodies and detect co-precipitated Rho proteins via Western blotting

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse SPCC191.03c to the N-terminal fragment of YFP

    • Fuse Rho proteins to the C-terminal fragment of YFP

    • Co-express in S. pombe and visualize reconstituted fluorescence

When analyzing results, consider that Rho GTPase interactions often depend on the nucleotide-bound state (GTP vs. GDP), as observed with pck1p and pck2p, which interact with rho1p only when bound to GTP .

How can I determine if SPCC191.03c affects cell wall integrity in S. pombe?

To evaluate potential roles of SPCC191.03c in cell wall integrity:

  • Generate and phenotype a deletion strain:

    • Create spcc191.03c∆ using PCR-based gene replacement

    • Test sensitivity to:

      • Cell wall stressors (Calcofluor White 50-200 μg/mL, Congo Red 50-100 μg/mL)

      • β-glucanase treatment (0.5-2 units/mL)

      • Osmotic stress (1-1.5 M sorbitol, 0.6-1.2 M KCl)

  • Measure cell wall composition:

    • Isolate cell walls by boiling cells in 2% SDS followed by extensive washing

    • Analyze β-glucan content using aniline blue staining and fluorimetry

    • Quantify α-glucan using FITC-conjugated α-glucan antibodies

    • Perform enzymatic fractionation to separate different polysaccharide components

  • Assess (1,3)β-D-glucan synthase activity:

    • Prepare membrane fractions from wild-type and spcc191.03c∆ strains

    • Measure incorporation of [14C]glucose from UDP-[14C]glucose into acid-precipitable material

    • Compare activity with positive controls (pck2+ overexpression increases activity)

If SPCC191.03c functions in the Rho1p-mediated cell integrity pathway, deletion strains may show defects similar to pck1Δ and pck2Δ mutants, which display cell wall abnormalities .

What experimental approaches can determine if SPCC191.03c has kinase activity?

To evaluate potential protein kinase activity of SPCC191.03c:

  • Sequence-based analysis:

    • Perform multiple sequence alignment with known protein kinases

    • Identify conserved catalytic residues (ATP-binding, substrate-binding motifs)

    • Search for kinase-specific domains using InterPro and SMART databases

  • In vitro kinase assays:

    • Purify recombinant SPCC191.03c with appropriate tags

    • Test for autophosphorylation activity using [γ-32P]ATP

    • Assess substrate phosphorylation using:

      • General substrates (myelin basic protein, histone H1)

      • S. pombe-specific substrates (cell wall biosynthetic enzymes)

    • Analyze phosphorylation by autoradiography or phospho-specific antibodies

  • Identify potential substrates:

    • Perform immunoprecipitation followed by mass spectrometry

    • Use ATP-analogue sensitive mutants for covalent capture of substrates

    • Apply phosphoproteomic analysis comparing wild-type and deletion strains

Based on structural analysis of protein kinase C homologues in S. pombe, look for conserved functional domains similar to pck1p and pck2p, particularly the amino-terminal region containing HR1 motifs that interact with GTP-bound Rho proteins .

How can I establish if SPCC191.03c genetically interacts with cell wall biosynthesis genes?

To systematically assess genetic interactions between SPCC191.03c and cell wall biosynthesis pathways:

  • Generate double mutants:

    • Cross spcc191.03c∆ with strains carrying mutations in:

      • cps1+ and gls2+ (encoding membrane subunits of (1,3)β-D-glucan synthase)

      • mok1+ (encoding α-glucan synthase)

      • bgs1+, bgs2+, bgs3+, and bgs4+ (β-glucan synthesis genes)

      • pck1+ and pck2+ (protein kinase C homologues)

    • Perform tetrad analysis to isolate double mutants

    • Assess viability, growth rates, and morphological phenotypes

  • Quantify genetic interactions:

    • Determine synthetic lethality/sickness through growth rate measurements

    • Calculate genetic interaction scores using colony size measurements

    • Generate genetic interaction networks through systematic analysis

  • Perform epistasis analysis:

    • Overexpress SPCC191.03c in cell wall mutant backgrounds

    • Test if SPCC191.03c overexpression suppresses or exacerbates mutant phenotypes

    • Establish hierarchical relationships within signaling pathways

Given the genetic interactions observed between pck1+ and cps1+/gls2+ in S. pombe, similar patterns might emerge with SPCC191.03c if it functions in related pathways .

What approaches can determine if SPCC191.03c functions in the Ras1-mediated signaling pathway?

To investigate potential roles of SPCC191.03c in Ras1 signaling:

  • Genetic interaction analysis:

    • Generate double mutants with ras1∆ and ral1∆

    • Assess phenotypes related to cell morphology, mating, and sporulation

    • Quantify genetic interaction scores under various stress conditions

  • Signaling pathway analysis:

    • Measure activation of downstream effectors (e.g., MAP kinases) in wild-type and spcc191.03c∆ strains

    • Assess cAMP levels and PKA activity in response to environmental stimuli

    • Monitor cell polarity markers and cytoskeletal organization

  • Epistasis testing:

    • Express constitutively active Ras1 (Ras1G17V) in spcc191.03c∆ background

    • Determine if activated Ras1 can suppress phenotypes of spcc191.03c∆

    • Conversely, test if SPCC191.03c overexpression can rescue ras1∆ defects

This approach is particularly relevant given the established genetic interaction between pck1+ and ras1+/ral1+ in S. pombe, suggesting functional links between these signaling pathways .

How can CRISPR-Cas9 genome editing be optimized for functional analysis of SPCC191.03c in S. pombe?

For precise genome editing of SPCC191.03c:

  • Guide RNA design and optimization:

    • Select target sites with minimal off-target potential using S. pombe-specific algorithms

    • Design gRNAs targeting both the 5' and 3' regions of the gene

    • Include proper RNA polymerase III promoters (e.g., SNR52 or U6)

  • Delivery system optimization:

    • Express Cas9 and gRNA from separate plasmids under different selectable markers

    • Use the medium-strength nmt41 promoter for Cas9 expression to minimize toxicity

    • Consider episomal vs. integrative expression systems

  • Homology-directed repair template design:

    • Include homology arms of at least 500 bp flanking the target site

    • Incorporate silent mutations in the PAM site to prevent re-cutting

    • Design templates for various modifications:

      • Precise point mutations to alter specific residues

      • Domain deletions to assess protein function

      • Epitope tag insertions for localization/purification

  • Validation strategies:

    • Design PCR primers spanning the edited region

    • Sequence verify all modifications

    • Confirm expression levels by RT-qPCR and Western blotting

When applying CRISPR-Cas9 in S. pombe, consider the haploid nature of this organism and optimize transformation protocols accordingly. The efficiency of homology-directed repair can be enhanced by synchronizing cells in G2 phase .

How can I investigate if SPCC191.03c impacts mating type switching or sexual differentiation in S. pombe?

To assess potential roles in sexual differentiation:

  • Analyze mating efficiency:

    • Generate homothallic (h90) spcc191.03cΔ strains

    • Quantify mating efficiency using microscopy-based assays

    • Calculate inbreeding coefficients using fluorescently tagged strains

    • Compare mating at different cell densities as this affects inbreeding coefficients

  • Assess mating-type switching:

    • Monitor switching frequency using colony staining assays

    • Analyze DNA recombination at the mating-type locus

    • Examine localization of switching-specific proteins (e.g., Swi5)

  • Evaluate shmoo formation and zygote morphology:

    • Quantify shmoo length in response to pheromone

    • Measure zygote/ascus dimensions

    • Compare with natural isolates showing diversity in these traits (e.g., S. kambucha)

S. pombe isolates show significant natural variation in mating phenotypes despite limited genetic diversity. Analyzing the role of SPCC191.03c in these processes could reveal important functional insights, particularly if it affects cell polarity or cell wall remodeling during sexual differentiation .

What proteomics approaches can identify the interactome of SPCC191.03c?

For comprehensive interactome analysis:

  • Proximity-based labeling approaches:

    • Generate SPCC191.03c fusions with BioID or TurboID biotin ligases

    • Express in S. pombe under native or controlled conditions

    • Purify biotinylated proteins using streptavidin beads

    • Identify interacting partners via mass spectrometry

  • Quantitative affinity purification-mass spectrometry (AP-MS):

    • Express epitope-tagged SPCC191.03c (TAP-tag or FLAG-tag)

    • Perform immunoprecipitation under varying stringency conditions

    • Include SILAC or TMT labeling for quantitative analysis

    • Filter against appropriate negative controls to remove false positives

  • Crosslinking mass spectrometry (XL-MS):

    • Apply cell-permeable crosslinkers to capture transient interactions

    • Purify SPCC191.03c complexes under denaturing conditions

    • Identify crosslinked peptides to map interaction interfaces

    • Generate structural models of protein complexes

  • Data analysis and network construction:

    • Apply statistical filtering to remove non-specific binders

    • Construct interaction networks with confidence scores

    • Perform Gene Ontology enrichment analysis

    • Compare with known interactomes of related proteins (e.g., protein kinase C homologues)

Focus analysis on known components of cell integrity pathways, particularly Rho GTPases and their effectors, as structural analysis indicates potential interactions similar to those observed between rho1p and protein kinase C homologues in S. pombe .

What approaches can resolve contradictory phenotypic data when analyzing SPCC191.03c function?

When facing conflicting phenotypic results:

  • Strain background analysis:

    • Compare phenotypes across different S. pombe isolates

    • Test if genetic background influences SPCC191.03c function

    • Create isogenic strains by backcrossing to a standard genetic background

    • Consider natural variation in mating phenotypes observed among S. pombe isolates

  • Environmental condition assessment:

    • Systematically test phenotypes under varying conditions:

      • Different carbon sources (glucose, glycerol, etc.)

      • Nutrient limitation (nitrogen, phosphate)

      • Temperature ranges (20-36°C)

      • Cell density effects (which can impact mating behaviors)

  • Conditional allele generation:

    • Create temperature-sensitive or auxin-inducible degron alleles

    • Analyze acute vs. chronic loss of function

    • Distinguish between primary and secondary phenotypic effects

  • Multi-method validation:

    • Combine genetic, biochemical, and cell biological approaches

    • Use complementary methodologies to verify key findings

    • Employ quantitative assays instead of qualitative observations

    • Apply statistical analysis to determine significance of phenotypic differences

This approach is particularly important when studying uncharacterized proteins like SPCC191.03c, where unexpected pleiotropy may result in complex phenotypes .

How can I design experiments to determine if SPCC191.03c functions in the context of meiotic drive systems?

To investigate potential roles in meiotic drive:

  • Genetic association analysis:

    • Map SPCC191.03c relative to known wtf meiotic drivers

    • Analyze linkage disequilibrium patterns in natural isolates

    • Determine if SPCC191.03c is associated with drive elements

  • Experimental evolution approaches:

    • Perform long-term evolution experiments with mixed populations

    • Track allele frequencies of SPCC191.03c and linked elements

    • Model population dynamics under varying inbreeding coefficients

  • Heterozygote analysis:

    • Create heterozygous diploids with different SPCC191.03c alleles

    • Measure spore viability patterns

    • Analyze segregation distortion using tetrad analysis

    • Quantify fitness effects in heterozygotes vs. homozygotes

The success of meiotic drivers in S. pombe is influenced by mating behaviors and inbreeding coefficients, which vary between natural isolates. Understanding if SPCC191.03c affects these processes could reveal important insights into its evolutionary significance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.