Recombinant Schizosaccharomyces pombe Uncharacterized protein C19D5.02c (SPAC19D5.02c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
SPAC19D5.02c; Uncharacterized protein C19D5.02c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-223
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC19D5.02c
Target Protein Sequence
LEIPISCAVSHNEQTEIFPHGTIDIPEMTFRPSDSQIDWSNLSHSDFVQCGVYEDSTNTW LAGASKYKIDEIKTLPKVPRDHYIILCDSSESNEIAKFTQVVHSFDFSSDSESAVVEQLH PSSPIPILTTAVRKKGSRPSKPQKEKQGNKQGSKTEESPNVDEDELESEPEEKTFFQKYG LYLIPILFLIIMSGNNANQQAANTAK
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is currently known about the cellular localization of SPAC19D5.02c?

Based on available research, SPAC19D5.02c has been identified as a potential peroxisomal membrane protein, specifically with similarities to Pex22 . This localization is significant as peroxisomal membrane proteins play crucial roles in organelle biogenesis and maintenance. Additionally, structural analysis using AlphaFold models has revealed homology with S. cerevisiae EMC10, which functions as a subunit of the ER membrane complex involved in membrane protein insertion . This dual association suggests the protein may have roles at membrane interfaces, potentially involved in protein trafficking or insertion mechanisms.

What homologs of SPAC19D5.02c have been identified across species?

Through reciprocal best structure hit (RBSH) analysis using AlphaFold structural models, SPAC19D5.02c has been identified as a structural homolog of S. cerevisiae EMC10. This was discovered despite the fact that sequence-based homology detection methods (like reciprocal best hits using BLASTP) did not identify this relationship . The structural similarity suggests evolutionary conservation of function despite sequence divergence. This finding is particularly valuable as it connects this previously uncharacterized protein to the well-studied ER membrane complex machinery, providing initial functional insights.

How does SPAC19D5.02c contribute to cytoplasmic freezing mechanisms in S. pombe?

SPAC19D5.02c has been implicated in studies investigating cytoplasmic freezing (CF) in S. pombe. During genome-wide screens for genes involved in CF, SPAC19D5.02c showed correlation values of 0.890 (ranked 295th) in one experimental repeat and 0.924 (ranked 277th) in another . These findings suggest the protein may participate in cellular adaptations during starvation or stress conditions.

To investigate this function experimentally, researchers should consider:

  • Creating deletion strains using standard gene replacement techniques

  • Monitoring cytoplasmic mobility during starvation using fluorescent particle tracking

  • Measuring the CF index in wildtype versus deletion strains

  • Assessing protein localization changes during the transition to CF state using fluorescent tagging

  • Examining interactions with known CF regulatory factors

Cytoplasmic freezing represents a dramatic reorganization of cellular architecture, suggesting SPAC19D5.02c may function in broader cellular stress responses beyond its membrane-associated roles.

What is the structural relationship between SPAC19D5.02c and the ER membrane complex?

The identification of SPAC19D5.02c as a structural homolog of S. cerevisiae EMC10 raises significant questions about its potential role in the ER membrane complex (EMC). The EMC is critical for the insertion of tail-anchored membrane proteins and transmembrane domains. To explore this relationship, researchers should consider:

  • Structural alignment comparison of AlphaFold models for both proteins, focusing on:

    • Conservation of key structural domains

    • Membrane-interacting regions

    • Potential binding sites

  • Experimental validation through:

    • Co-immunoprecipitation with known EMC components in S. pombe

    • Functional complementation assays in S. cerevisiae emc10 deletion strains

    • Assessment of membrane protein insertion defects in SPAC19D5.02c deletion strains

This structural relationship provides a hypothesis for one function of this previously uncharacterized protein, potentially connecting peroxisomal and ER membrane protein insertion machinery.

How does SPAC19D5.02c function differ between normal growth and starvation conditions?

Given the protein's potential involvement in cytoplasmic freezing (a starvation response) and its predicted membrane localization, an important research question involves its differential function across cellular states. Comparative analysis should examine:

  • Expression levels across growth phases using RT-qPCR and western blotting

  • Spatial redistribution during starvation using fluorescent microscopy

  • Post-translational modifications specific to different metabolic states

  • Protein-protein interaction networks in normal versus starved conditions

  • Functional consequences of protein absence in adaptation to and recovery from starvation

What are the optimal conditions for expression and purification of recombinant SPAC19D5.02c?

For researchers seeking to work with the recombinant protein, optimizing expression and purification conditions is essential. Based on available information and standard approaches for S. pombe membrane proteins:

Expression Systems:

  • E. coli BL21(DE3) with codon optimization for membrane proteins

  • Yeast expression systems (particularly S. cerevisiae or P. pastoris) for proper folding

  • Insect cell expression for complex eukaryotic proteins

Purification Strategy:

  • Initial extraction using mild detergents (DDM, LDAO) for membrane proteins

  • IMAC purification via histidine tag

  • Size exclusion chromatography for final purity

  • Quality assessment via SDS-PAGE and western blotting

Buffer Optimization Table:

Buffer ComponentRecommended RangeOptimization Considerations
pH7.0-8.0Test pH stability with thermal shift assays
NaCl150-300 mMAdjust based on protein solubility
Glycerol10-25%Higher concentrations for long-term storage
Detergent1-3× CMCTest multiple detergent types
Reducing Agent1-5 mM DTT or TCEPFresh addition before experiments

Store the purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage. Avoid repeated freeze-thaw cycles to maintain protein integrity .

What are the recommended approaches for studying SPAC19D5.02c localization and dynamics?

To accurately characterize the cellular localization and dynamics of SPAC19D5.02c, researchers should implement multiple complementary approaches:

  • Fluorescent Protein Tagging:

    • C-terminal vs. N-terminal GFP fusion constructs

    • Verification that tags don't disrupt protein function

    • Live cell imaging under various conditions (growth, starvation, stress)

  • Subcellular Fractionation:

    • Separation of peroxisomal, ER, and cytosolic fractions

    • Western blot analysis with compartment-specific markers

    • Quantification of protein distribution across fractions

  • Immunoelectron Microscopy:

    • Ultra-structural localization at membrane interfaces

    • Co-localization with known peroxisomal and ER markers

    • Quantitative spatial analysis of gold particle distribution

  • Dynamic Studies:

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

    • Single particle tracking during normal growth vs. starvation

    • Time-lapse imaging during transition to cytoplasmic freezing state

When designing these experiments, researchers should be mindful that membrane proteins often exist in multiple pools with different dynamics, requiring careful quantitative analysis to distinguish genuine localization from artifacts.

What methodologies are most effective for identifying interaction partners of SPAC19D5.02c?

Understanding the protein interaction network of SPAC19D5.02c is crucial for elucidating its function. Several complementary approaches are recommended:

  • Proximity-dependent Biotin Identification (BioID):

    • Fusion of SPAC19D5.02c with a biotin ligase

    • Identification of proximal proteins via streptavidin pulldown and mass spectrometry

    • Particularly useful for membrane proteins with transient interactions

  • Affinity Purification-Mass Spectrometry:

    • Tandem affinity purification using epitope tags

    • Crosslinking to capture transient interactions

    • SILAC labeling for quantitative comparison across conditions

  • Yeast Two-Hybrid Screening with Split-Ubiquitin System:

    • Modified Y2H system optimized for membrane proteins

    • Screening against S. pombe genomic libraries

    • Validation of hits with targeted co-immunoprecipitation

  • In silico Prediction Based on Structural Homology:

    • Analysis of EMC10 interaction partners in S. cerevisiae

    • Identification of conserved binding motifs in the SPAC19D5.02c structure

    • Prioritization of candidates for experimental validation

Integration of these approaches can help build a comprehensive interaction map, revealing functional associations with both the peroxisomal import machinery and ER membrane complex components.

How should researchers interpret contradictory localization data for SPAC19D5.02c?

When analyzing SPAC19D5.02c, researchers may encounter seemingly contradictory data regarding its localization as both a peroxisomal protein (Pex22) and a structural homolog of the ER protein EMC10 . This discrepancy requires careful interpretation:

  • Dual Localization Hypothesis:

    • Some membrane proteins genuinely localize to multiple organelles

    • Quantify the relative abundance in each compartment using fractionation and western blotting

    • Test if localization changes under different conditions (growth phase, stress)

  • Functional Separation Analysis:

    • Create targeted mutations affecting specific localization signals

    • Assess which pool of the protein contributes to different cellular functions

    • Examine if the protein shuttles between compartments

  • Resolution Through Improved Methodology:

    • Compare results from different tagging approaches (N vs. C-terminal tags)

    • Use super-resolution microscopy to distinguish closely associated membranes

    • Apply proximity labeling to definitively establish organelle-specific interactions

  • Evolutionary Context Interpretation:

    • Analyze whether homologs in related species show similar dual localization

    • Consider if gene duplication/specialization events have occurred in other fungi

    • Examine if the dual role reflects an ancestral function at organelle contact sites

A systematic approach to these contradictions can transform an apparent inconsistency into a novel insight about organelle cooperation in membrane protein trafficking.

What considerations are important when analyzing SPAC19D5.02c structural data from AlphaFold predictions?

AlphaFold structural predictions have identified SPAC19D5.02c as a structural homolog of S. cerevisiae EMC10, despite limited sequence similarity. When interpreting these structural predictions, researchers should consider:

How can researchers integrate cytoplasmic freezing data with membrane protein function of SPAC19D5.02c?

The involvement of SPAC19D5.02c in both membrane organization and cytoplasmic freezing presents an intriguing functional connection. To effectively integrate these seemingly distinct aspects:

  • Mechanistic Hypothesis Development:

    • Explore if membrane reorganization precedes or follows cytoplasmic immobilization

    • Investigate whether the protein mediates interactions between the cytoskeleton and membranes

    • Consider if it functions in stress-induced membrane protein quality control

  • Correlative Data Analysis:

    • Compare the timing of SPAC19D5.02c relocalization with cytoplasmic mobility changes

    • Analyze whether interaction partners shift during the transition to frozen cytoplasm

    • Assess if post-translational modifications coincide with CF induction

  • Comparative Analysis Across Deletion Strains:

    • Compare the CF index of SPAC19D5.02c deletion with other membrane protein mutants

    • Create a matrix of phenotypic correlations across multiple membrane-associated deletions

    • Look for epistatic relationships with known CF regulators

This integration might reveal novel mechanisms by which membrane reorganization contributes to global cytoplasmic properties during cellular stress responses, particularly in the context of nutrient deprivation and quiescence entry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.