Recombinant Schizosaccharomyces pombe Uncharacterized protein C19F5.03 (SPBC19F5.03)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPBC19F5.03; Uncharacterized protein C19F5.03
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC19F5.03
Target Protein Sequence
MVQFEANEKQFKLRREDCCLTIDRESGAVSFEPDELKPVARSKENSVTLFGSIKLKKDKY LILATEKSSAAQILGHKIYRVHKFEVIPYRNLLADDQDELDLYNLLQNHLKTGPFYFSYT WDLTNSLQRSCTDEGKASPILRSDKRFFWNEFASKDFIDLIGAHSEVSLFITPMIYGFIT SASTIVKGRTITLALISRRSKQRAGTRYFTRGLDENGNPANFNETEQITIVSDEKSEVTY SHVQTRGSVPAFWAEVNNLRYKPLMVANSASMAAAAAKKHFDEQISIYGDQVVVNLVNCK GHELPIKQLYENVIRRLDNPHIHYHYFDFHKECSHMRWDRVSLLLNEIQPELEEQGYTTL DTQKYRVLSRQNGVVRSNCMDCLDRTNVVQSCIGRWVLTNQLRKCGIIGATHPLRSVIPL DNIFCNIWSDNADYISLSYSGTGALKTDFTRTGIRTRKGAFNDFVNSAKRYILNNFYDGA RQDAYDLVLGQFRPDVNFRYRLDLRPLTIRCVPYILLACLILFFMTLFSRSSSTILPPSI LLILTFLGIVASLYYCFAHGLQFINWPRLLLPSFLRSDMTPEGRVFVINRQLASKHKV
Uniprot No.

Target Background

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Schizosaccharomyces pombe Uncharacterized protein C19F5.03 (SPBC19F5.03)?

SPBC19F5.03 is a phosphatidylinositol-3-phosphatase SAC1 encoded in the genome of Schizosaccharomyces pombe strain 972 / ATCC 24843, commonly known as fission yeast . The protein is identified in UniProt with accession number O60162 and is also referenced as YG23_SCHPO in some databases . It belongs to the broader family of phosphatidylinositol phosphatases that play critical roles in membrane trafficking and lipid signaling pathways. The protein is sometimes referred to by its short label "Spom972h-SACM1L" in the scientific literature, indicating its homology to SACM1L proteins in other organisms . Although classified as "uncharacterized," recent research has begun to elucidate its functional properties and biological significance within the cell.

What is the complete amino acid sequence of SPBC19F5.03?

The complete amino acid sequence of SPBC19F5.03 consists of 598 amino acids and is as follows:

MVQFEANEKQFKLRREDCCLTIDRESGAVSFEPDELKPVARSKENSVTLFGSIKLKKDKYLILATEKSSAAQILGHKIYRVHKFEVIPYRNLLADDQDELDLYNLLQNHLKTGPFYFSYTWDLTNSLQRSCTDEGKASPILRSDKRFFWNEFASKDFIDLIGAHSEVSLFITPMIYGFITSASTIVKGRTITLALISRRSKQRAGTRYFTRGLDENGNPANFNETEQITIVSDEKSEVTYSHVQTRGSVPAFWAEVNNLRYKPLMVANSASMAAAAAKKHFDEQISIYGDQVVVNLVNCKHELPIKQLYENVIRRLDNPHIHYHYFDFHKECSHMRWDRVSLLLNEIQPELEEQGYTTLDTQKYRVLSRQNGVVRSNCMDCLDRTNVVQSCIGRWVLTNQLRKCGIIGATHPLRSVIPLDNIFCNIWSDNADYISLSYSGTGALKTDFTRTGIRTRKGAFNDFVNSAKRYILNNFYDGARQDAYDLVLGQFRPDVNFRYRLDLRPLTIRCVPYILLACLILFFMTLFSRSSSTILPPSILLILTFLGIVASLYYCFAHGLQFINWPRLLLPSFLRSDMTPEGRVFVINRQLASKHKV

The protein sequence contains multiple domains and functional motifs that contribute to its enzymatic activity. Researchers should pay particular attention to the conserved SAC1 domain, which is critical for its phosphatase activity. When working with recombinant versions of this protein, it is essential to verify that the construct contains the complete sequence to ensure proper folding and function in experimental systems.

Why is Schizosaccharomyces pombe useful as a model organism for studying SPBC19F5.03?

Schizosaccharomyces pombe (S. pombe) has emerged as a prominent model system for investigating various biological processes that are highly conserved in mammalian cells, making it an excellent choice for studying proteins like SPBC19F5.03 . This unicellular fission yeast offers several advantages including a well-characterized genome, relatively simple genetic manipulation, and cellular processes that closely resemble those in higher eukaryotes. The ultrastructure of S. pombe cells provides valuable insights into organelle morphology and comprehensive overviews of cellular functions, which is particularly relevant when studying membrane-associated proteins like SPBC19F5.03 . In recent years, S. pombe has proven to be a suitable cell system for transmission electron microscopy investigations, allowing researchers to examine cellular architecture under physiological conditions as well as ultrastructural changes in response to various treatments . Additionally, S. pombe's rapid growth rate and the availability of numerous genetic tools make it an ideal system for functional characterization of proteins through gene deletion, mutation, and overexpression studies.

What are the optimal conditions for expression and purification of recombinant SPBC19F5.03?

For optimal expression and purification of recombinant SPBC19F5.03, researchers should consider several critical parameters. Based on standard protocols for similar yeast proteins, expression in either E. coli or yeast expression systems can be effective, with each offering distinct advantages. For E. coli expression, BL21(DE3) strains containing chaperone plasmids often improve solubility of yeast proteins. Induction should be performed at a lower temperature (16-20°C) with 0.1-0.5 mM IPTG to reduce inclusion body formation. For S. pombe homologous expression, the nmt1 promoter system allows for controlled induction using thiamine withdrawal. Purification typically involves a multi-step approach starting with affinity chromatography (His-tag or GST-tag), followed by ion exchange and size exclusion chromatography to achieve high purity. The purification buffer should contain 20-50 mM Tris-HCl (pH 7.5-8.0), 150-300 mM NaCl, 5-10% glycerol, and potentially 0.5-1 mM DTT to maintain protein stability . After purification, the recombinant protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage, and repeated freeze-thaw cycles should be avoided to maintain enzymatic activity .

How can I validate the activity of recombinant SPBC19F5.03?

Validating the enzymatic activity of recombinant SPBC19F5.03 requires multiple complementary approaches to confirm its phosphatidylinositol-3-phosphatase activity. First, develop an in vitro phosphatase assay using fluorescent or radiolabeled phosphatidylinositol substrates, measuring the release of phosphate groups through colorimetric methods or thin-layer chromatography. Malachite green assays can be particularly useful for detecting released inorganic phosphate with high sensitivity. Second, perform substrate specificity tests using various phosphoinositides (PI3P, PI4P, PI5P) to confirm the enzyme's preference for PI3P as expected for a SAC1 phosphatase. Third, conduct kinetic analyses to determine Km and Vmax values, which provide quantitative measures of enzyme efficiency. Fourth, employ site-directed mutagenesis to generate catalytically inactive variants by targeting conserved residues in the phosphatase domain, which should serve as negative controls. Finally, complement these biochemical approaches with cellular assays by expressing the recombinant protein in sac1Δ mutant S. pombe strains and assessing rescue of phenotypes such as membrane trafficking defects or altered phosphoinositide levels using specific lipid probes . These multi-faceted validation strategies ensure that the recombinant protein maintains its native enzymatic properties.

What role might SPBC19F5.03 play in the TTT-PIKK pathway?

The potential role of SPBC19F5.03 in the TTT-PIKK pathway represents an intriguing research direction based on current understanding of phosphoinositide signaling and kinase regulation. Recent studies have identified the TTT complex (Tel2-Tti1-Tti2) as an essential Hsp90 cochaperone that specifically stabilizes phosphatidylinositol 3-kinase-related kinases (PIKKs) during their translation and maturation . As SPBC19F5.03 functions as a phosphatidylinositol-3-phosphatase, it may regulate the availability of phosphoinositide substrates required for PIKK activity. The TTT complex binds to PIKKs during translation through recognition of their most conserved domains, protecting nascent PIKK polypeptides from misfolding and degradation . Given this mechanism, SPBC19F5.03 might indirectly modulate PIKK maturation by controlling phosphoinositide pools at specific cellular compartments. Furthermore, the temporal segregation of PIKK maturation and assembly suggests a sophisticated regulatory network where phosphatases like SPBC19F5.03 could provide additional control points. Investigating potential genetic or physical interactions between SPBC19F5.03 and components of the TTT complex using techniques such as synthetic genetic arrays or co-immunoprecipitation could reveal functional connections in this important signaling network.

How can researchers address contradictory findings about SPBC19F5.03 function in the literature?

Addressing contradictory findings about SPBC19F5.03 function requires a systematic approach to context analysis and experimental design. Researchers should first categorize contradictions based on Sarafraz's framework: logical contradictions in biology, contradictions in literature, or contradictions in extracted data due to incomplete context . Most conflicts in the literature arise from underspecified experimental contexts, including differences in species, temporal context, and environmental conditions . To resolve these discrepancies, implement a structured analysis framework that normalizes gene/protein terminology (ensuring SPBC19F5.03, YG23_SCHPO, and Spom972h-SACM1L are recognized as the same entity) and explicitly accounts for experimental variables like strain backgrounds, growth conditions, and assay methods . When designing new experiments, standardize protocols and include comprehensive documentation of all potentially relevant variables. Consider adopting Alamri's approach of defining specific question types to evaluate contradictory claims, such as "Does SPBC19F5.03 exhibit phosphatase activity against PI3P in vitro?" . Additionally, apply semantic precision by distinguishing between contradictions (opposing findings under identical conditions) and contrasts (different findings under different conditions). This methodological rigor will help resolve apparent contradictions and advance understanding of SPBC19F5.03's true biological functions.

What techniques are most effective for studying post-translational modifications of SPBC19F5.03?

For comprehensive characterization of post-translational modifications (PTMs) of SPBC19F5.03, a multi-faceted analytical approach is essential. Mass spectrometry-based proteomics represents the gold standard, with phosphoproteomics being particularly relevant given the protein's phosphatase function. Implement a workflow combining titanium dioxide enrichment for phosphopeptides with high-resolution LC-MS/MS analysis, preferably using Orbitrap or QTOF instruments capable of detecting sub-stoichiometric modifications. Complement this with targeted approaches such as Parallel Reaction Monitoring (PRM) or Multiple Reaction Monitoring (MRM) for quantitative analysis of specific modified residues. For in vivo studies, develop phospho-specific antibodies against predicted modification sites or employ epitope-tagging strategies with subsequent immunoprecipitation and Western blotting using modification-specific antibodies. Additionally, leverage genetic approaches by introducing phosphomimetic (S/T to D/E) or phospho-deficient (S/T to A) mutations at candidate sites to assess functional consequences. For temporal dynamics of PTMs, perform pulse-chase experiments combined with quantitative proteomics. Cross-reference any identified PTMs with databases like iPTMnet to place findings in broader context . This comprehensive strategy will reveal how PTMs regulate SPBC19F5.03's enzymatic activity, localization, and protein-protein interactions, providing crucial insights into its regulation within cellular signaling networks.

How can I design experiments to elucidate the role of SPBC19F5.03 in phosphatidylinositol signaling?

Designing experiments to elucidate SPBC19F5.03's role in phosphatidylinositol signaling requires a multi-dimensional approach combining genetics, biochemistry, and advanced imaging techniques. Begin with a comprehensive genetic strategy by creating a deletion strain (spbc19f5.03Δ) and conditional expression strains (using nmt1 promoter variants for titratable expression) to observe phenotypic effects on growth, cell morphology, and membrane trafficking. Implement a synthetic genetic array (SGA) analysis by crossing the deletion strain with mutants of known phosphoinositide pathway components to identify genetic interactions. For biochemical characterization, purify recombinant SPBC19F5.03 and perform in vitro lipid phosphatase assays against various phosphoinositide substrates to establish specificity profiles . Develop a phosphoinositide sensor panel using fluorescently tagged lipid-binding domains (e.g., PH, FYVE, PX domains) to visualize phosphoinositide distribution in wild-type versus mutant cells. Apply advanced imaging techniques including TIRF microscopy to monitor plasma membrane phosphoinositide dynamics and correlative light and electron microscopy to link phosphoinositide distributions with membrane ultrastructure . Complement these approaches with lipidomic analyses using LC-MS/MS to quantify changes in phosphoinositide species. Finally, perform protein interaction studies using BioID or proximity labeling approaches to identify binding partners that might function within the same signaling networks.

What are the best practices for using S. pombe as a model system for SPBC19F5.03 studies?

Implementing best practices for S. pombe as a model system for SPBC19F5.03 studies requires attention to several methodological details that significantly impact experimental outcomes. First, strain selection is crucial - utilize the standard laboratory strain 972h- for consistency with existing literature, as this strain has been well-characterized and contains the reference genome in which SPBC19F5.03 was originally annotated . Maintain cultures in appropriate media (YES for general growth, EMM for selective conditions) with regular strain verification to prevent contamination or genetic drift. For genetic manipulations, employ homologous recombination-based techniques for gene tagging, deletion, or modification, ideally using PCR-generated cassettes with 80-100bp homology regions for optimal integration efficiency. When analyzing phenotypes, consider multiple cellular processes that might be affected by SPBC19F5.03 perturbation, including membrane trafficking, lipid homeostasis, cell cycle progression, and stress responses. For microscopy-based studies, transmission electron microscopy offers unique insights into cellular ultrastructure and organelle morphology that might reveal phenotypes not visible by light microscopy . Additionally, consider using temperature-sensitive mutants (25°C permissive, 36°C restrictive) to study essential functions. Finally, validate key findings using complementary approaches in both S. pombe and other model systems to establish the evolutionary conservation of SPBC19F5.03 functions.

How can transmission electron microscopy enhance our understanding of SPBC19F5.03 function?

Transmission electron microscopy (TEM) provides powerful capabilities for investigating SPBC19F5.03 function at the ultrastructural level, revealing phenotypes and mechanisms invisible to conventional light microscopy. S. pombe has proven to be an excellent model system for TEM investigations, allowing visualization of cellular architecture under physiological conditions and detection of subtle changes in membrane organization that may result from altered phosphoinositide metabolism . For studying SPBC19F5.03, implement both conventional and immuno-electron microscopy approaches. Conventional TEM sample preparation through chemical fixation, dehydration, and embedding in resin enables visualization of general membrane organization, vesicle trafficking pathways, and organelle morphology in wild-type versus spbc19f5.03Δ strains. Complement this with immuno-gold labeling using antibodies against SPBC19F5.03 or epitope-tagged versions to precisely localize the protein within cellular compartments with nanometer precision. Cryo-electron microscopy techniques, including freeze-substitution and vitreous sectioning, preserve membrane structures in a near-native state, minimizing fixation artifacts that can confound interpretation of membrane phenotypes. For dynamic processes, correlative light and electron microscopy (CLEM) combines live-cell imaging of fluorescently tagged SPBC19F5.03 with subsequent electron microscopy of the same cells, enabling temporal information to be integrated with ultrastructural details . These complementary TEM approaches provide unique insights into SPBC19F5.03's role in membrane organization and trafficking pathways.

What emerging technologies could advance research on SPBC19F5.03?

Several cutting-edge technologies hold tremendous potential for advancing our understanding of SPBC19F5.03 structure, function, and regulation. CRISPR-Cas9 genome editing techniques optimized for S. pombe enable precise manipulation of the endogenous gene, allowing researchers to introduce specific mutations, regulatory elements, or fluorescent tags at the native locus with minimal disruption to genomic context. Cryo-electron microscopy represents a revolutionary approach for determining the three-dimensional structure of SPBC19F5.03 at near-atomic resolution without the need for crystallization, potentially revealing mechanistic insights into substrate recognition and catalysis. Proximity labeling methods such as BioID or TurboID can identify the protein interaction network of SPBC19F5.03 in living cells, capturing even transient interactions that traditional co-immunoprecipitation might miss. Advanced live-cell imaging techniques, including lattice light-sheet microscopy with adaptive optics, provide unprecedented spatiotemporal resolution for tracking SPBC19F5.03 dynamics in relation to membrane trafficking events and cellular compartments. Single-cell proteomics and phosphoproteomics can reveal cell-to-cell variability in SPBC19F5.03 expression and modification states, potentially uncovering regulatory mechanisms invisible to population-averaged measurements. Microfluidics-based approaches enable precise control of cellular environment and real-time monitoring of responses to perturbations in phosphoinositide metabolism. Finally, integrative multi-omics approaches combining genomics, transcriptomics, proteomics, and lipidomics will provide comprehensive datasets for systems-level understanding of SPBC19F5.03 function within broader cellular networks.

How might understanding SPBC19F5.03 contribute to broader phosphoinositide research?

Understanding SPBC19F5.03 has significant implications for advancing the broader field of phosphoinositide research through several key contributions. As a phosphatidylinositol-3-phosphatase in the evolutionarily conserved SAC1 family, detailed characterization of SPBC19F5.03 provides valuable insights into fundamental mechanisms of phosphoinositide metabolism that are likely preserved from yeast to humans . The relatively simple genetic background of S. pombe offers a powerful system for dissecting the precise roles of individual phosphoinositide-modifying enzymes without the complexity and redundancy often encountered in mammalian systems. Research on SPBC19F5.03 can illuminate the specific roles of PI3P in membrane trafficking pathways, organelle identity maintenance, and cellular stress responses. The protein may serve as an excellent model for studying how phosphoinositide phosphatases integrate into broader signaling networks, potentially including connections to the TTT-PIKK pathway that regulates critical cellular processes like DNA damage response and nutrient sensing . Additionally, the detailed structural and functional characterization of SPBC19F5.03 can provide templates for understanding human phosphoinositide phosphatases implicated in diseases such as cancer, neurodegeneration, and metabolic disorders. By leveraging S. pombe's amenability to genetic manipulation and advanced microscopy techniques, studies of SPBC19F5.03 can pioneer new methodological approaches for investigating membrane-associated enzymes that can be subsequently applied to more complex systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.