Recombinant Schizosaccharomyces pombe Uncharacterized protein C1A6.05c (SPAC1A6.05c)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Schizosaccharomyces pombe Uncharacterized Protein C1A6.05c (SPAC1A6.05c)

Schizosaccharomyces pombe Uncharacterized Protein C1A6.05c (SPAC1A6.05c) is a protein in the fission yeast Schizosaccharomyces pombe. Genes including SPCC1450.16c, SPAC1786.01c, and SPAC1A6.05c show a high level of homology to Saccharomyces cerevisiae TG lipase genes, namely TGL3, TGL4, and TGL5 .

Functional Characterization

SPAC1A6.05c is a triacylglycerol lipase involved in the mobilization of triacylglycerols in S. pombe .

2.1. Role in Triglyceride Metabolism

Deletion of the SPAC1A6.05c gene in S. pombe leads to an increase in triglyceride content, suggesting its involvement in TG metabolism . Deletion of each gene (SPCC1450.16c, SPAC1786.01c and SPAC1A6.05c) increased TG content by approximately 1.7-fold compared to the parental wild-type strain, and their triple deletion mutant further increased TG content to 2.7-fold of the wild-type strain, suggesting that all three genes encode TG lipase and are functioning in S. pombe .

2.2. Sensitivity to Cerulenin

The triple deletion mutant (SPCC1450.16c, SPAC1786.01c and SPAC1A6.05c) shows sensitivity to cerulenin, an inhibitor of fatty acid synthesis, which can be restored by adding oleic acid in media .

Homology and Evolutionary Conservation

SPAC1A6.05c shows homology to triglyceride lipase genes found in Saccharomyces cerevisiae, indicating a conserved function across different yeast species .

Implications for Drug Resistance

Loss of S. pombe lac1 results in multidrug sensitivity . Loss of both rav1 and lac1 is additive, as the double mutants exhibited greater drug sensitivity than either single mutant, suggesting that Rav1 and Lac1 act in different pathways to influence innate drug resistance .

Role in Membrane Structure

Loss of S. pombe lac1 results in heat shock sensitivity and disruption of plasma membrane sterol distribution .
In growing cells, sterols are detected at the plasma membrane and enriched specifically at the growing tips of the cell and also at the site of cytokinesis in cells undergoing division . Strikingly, in lac1Δ mutant cells, but not rav1Δ and lag1Δ mutant cells, the pattern of filipin fluorescence was distributed evenly around the entire cell, suggesting that the structure of the plasma membrane is abnormal in this mutant .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ptl3; SPAC1A6.05c; Triacylglycerol lipase ptl3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-483
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC1A6.05c
Target Protein Sequence
MSKNEIKLQMEYASSYETWLEAAEKLDVIEGKYQWREQKESDEYDYVLVESRLHELRRHR LSKNTRLLLGLLRNSVARDFANMDNSRLYNYAHSGTKKLIDEFIQEVLMCLTYLEETPDL SLDEKITEFSRLKLTTGNTALILSGGGTFGMTHIGVLQSLHEQGLVPKIICGSSAGAIVA CAAAVRNKEEQEILLRQFHTGDLSVFTDPNAAPPSVIQSVKQYFTRGCVLDISHLERVMK LLIGDFTFQEAYDRSGYILNVTVSCGSLFEMPSLLNYITAPNVLVWSAVVATCSVPFLFK RATLWERDPLTREVSAFCVTDAPLWMDGSVDNDIPHAKLTELFHVNHFIVSQVNFHIVPF IMDPTSHNWVERCCKKAIDLAAQEVSLTFRLFAELGIFSVLFTKLQSVITQKYSGDITII PRLNYREVNKVIKNPTPSFLLDAATRGKRGTWTKVPVTRNHCAIEILIAAAYTRLIKRSK SLK
Uniprot No.

Target Background

Function
This protein is a lipid particle-localized triacylglycerol (TAG) lipase. Lipid droplets/particles serve as energy storage compartments and provide building blocks for membrane lipid biosynthesis. This lipase is involved in mobilizing the non-polar storage lipids, triacylglycerols (TAGs), from lipid particles. It achieves this through TAG hydrolysis, releasing fatty acids that are then supplied to relevant metabolic pathways.
Database Links
Subcellular Location
Cytoplasm. Lipid droplet.

Q&A

What expression systems can be used for SPAC1A6.05c recombinant production?

Multiple expression systems can be employed for the recombinant production of SPAC1A6.05c, each with distinct advantages depending on your experimental goals. The table below summarizes the major expression platforms and their characteristics:

Expression SystemAdvantagesLimitationsSuitable Applications
E. coliHigh yield, simple culture conditions, economical, rapid expressionLimited post-translational modifications, potential inclusion body formationBasic structural studies, antibody production, preliminary activity assays
Yeast (S. cerevisiae, P. pastoris)Eukaryotic PTMs, high-density cultures, proper folding of eukaryotic proteinsLonger expression time than E. coli, hypermannosylationFunctional studies, structural analysis requiring authentic folding
Insect cells (Sf9, Sf21, High Five)Complex eukaryotic PTMs, high expression of membrane proteinsTechnical expertise required, higher cost than microbial systemsStructural biology of complex proteins, interaction studies
Mammalian cells (293T, CHO, etc.)Human-like PTMs, authentic foldingHighest cost, longer timeline, technical complexityDetailed functional assays, therapeutic protein development

The choice of tag position and fusion partner significantly impacts expression, solubility, and downstream applications. His-tags facilitate purification via metal affinity chromatography, while larger fusion partners like MBP, GST, or trxA can enhance solubility .

How can I optimize recombinant SPAC1A6.05c expression and purification?

Optimization of SPAC1A6.05c expression requires systematic evaluation of multiple parameters:

Expression Optimization:

  • Codon optimization: Analyze the codon usage in SPAC1A6.05c and adapt it to the expression host. This is particularly important when expressing S. pombe proteins in E. coli or mammalian systems .

  • Induction conditions: For E. coli expression, test various IPTG concentrations (0.1-1.0 mM), induction temperatures (16-37°C), and induction durations (4-24 hours). Lower temperatures (16-25°C) often improve solubility of eukaryotic proteins.

  • Media composition: Enriched media such as TB or auto-induction media can significantly increase yields compared to standard LB medium.

  • Fusion tags selection: Test different fusion partners:

    • His-tag for simple purification

    • MBP or GST for enhanced solubility

    • Combinations of affinity and solubility tags

Purification Strategy:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Intermediate purification: Ion exchange chromatography based on SPAC1A6.05c's theoretical pI

  • Polishing step: Size exclusion chromatography

  • Buffer optimization: Screen different pH values (7.0-8.5) and salt concentrations (50-500 mM) to maintain stability

The optimal storage buffer for purified SPAC1A6.05c includes Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, add 5-50% glycerol (final concentration) and store aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles .

What methodologies can be used to characterize SPAC1A6.05c enzymatic activity?

As SPAC1A6.05c is predicted to function as a triacylglycerol lipase, multiple complementary approaches should be employed to characterize its enzymatic activity:

Lipase Activity Assays:

  • Spectrophotometric assays:

    • p-nitrophenyl ester hydrolysis (pNP-esters with varying acyl chain lengths)

    • pH-indicator based assays monitoring fatty acid release

    • Fluorogenic substrate assays (e.g., 4-methylumbelliferyl-based substrates)

  • Radiometric assays:

    • [³H]-labeled or [¹⁴C]-labeled triacylglycerol substrates followed by thin-layer chromatography separation

  • Natural substrate analysis:

    • Gas chromatography-mass spectrometry (GC-MS) for fatty acid release quantification

    • HPLC-based methods for glyceride analysis

Enzyme Kinetics Parameters:

Set up assays with varying substrate concentrations to determine:

  • Km (substrate affinity)

  • kcat (turnover number)

  • kcat/Km (catalytic efficiency)

  • Inhibition constants with known lipase inhibitors

Substrate Specificity Profiling:

Test activity against various lipid substrates to create a specificity profile:

  • Triacylglycerols with different fatty acid compositions

  • Diacylglycerols

  • Monoacylglycerols

  • Phospholipids

  • Cholesteryl esters

Compare the activity profile with other characterized lipases to position SPAC1A6.05c within the lipase functional classification .

How can genetic interaction data inform SPAC1A6.05c function?

Genetic interaction data from E-MAP (Epistatic Miniarray Profile) studies provide valuable insights into the functional context of SPAC1A6.05c:

Significant Genetic Interactions of SPAC1A6.05c (ptl3):

Interacting GeneSystematic IDInteraction ScoreFunction
brc1Not specified2.2921DNA repair protein
msh2SPBC19G7.01C2.3301MutS protein homolog 2
csi1SPBC2G2.142.1446Chromosome segregation protein
erg5SPAC19A8.042.2957C-22 sterol desaturase

These positive genetic interactions (synthetic rescue or positive epistasis) suggest that SPAC1A6.05c may have functional relationships with DNA repair pathways, chromosomal maintenance, and sterol metabolism in S. pombe .

To interpret these results:

  • Pathway analysis: Look for enriched biological processes among interacting genes

  • Literature integration: Connect identified interactions with known lipid metabolism roles

  • Validation experiments: Confirm genetic interactions through double mutant growth assays

  • Mechanistic investigation: Explore how lipid metabolism might connect to DNA repair and chromosomal processes

This approach can generate hypotheses about SPAC1A6.05c's role beyond its predicted lipase function, potentially revealing moonlighting functions or metabolic connections between lipid homeostasis and genome maintenance .

How can I design loss-of-function and gain-of-function experiments for SPAC1A6.05c?

Loss-of-Function Approaches:

  • CRISPR-Cas9 gene knockout:

    • Design guide RNAs targeting early exons of SPAC1A6.05c

    • Include repair templates with selectable markers

    • Confirm deletions via PCR, sequencing, and Western blotting

    • Assay for lipid metabolism phenotypes (lipid droplet accumulation, fatty acid composition)

  • RNAi-mediated knockdown:

    • Design dsRNA targeting SPAC1A6.05c with minimal off-target effects

    • Validate knockdown efficiency by RT-qPCR and Western blotting

    • Compare phenotypes with complete knockout to identify dosage-sensitive functions

  • Degron tagging for conditional depletion:

    • Tag endogenous SPAC1A6.05c with auxin-inducible degron

    • Use time-course experiments to track acute versus chronic effects of protein loss

Gain-of-Function Approaches:

  • Overexpression strategies:

    • Use strong promoters (e.g., nmt1 promoter) for constitutive expression

    • Employ inducible promoters for temporal control

    • Create expression constructs with and without tags to assess tag interference

  • Structure-function analysis:

    • Generate predicted catalytic site mutants (e.g., serine → alanine in the catalytic triad)

    • Create chimeric proteins with other characterized lipases

    • Express truncated versions to identify functional domains

  • Reporter systems:

    • Fusion with fluorescent proteins for localization studies

    • Split reporter systems for interaction studies

Experimental Controls:

  • Genetic background controls:

    • Isogenic wild-type strains

    • Complementation with wild-type SPAC1A6.05c to confirm phenotype specificity

  • Pathway controls:

    • Knockout/overexpression of other known lipases

    • Chemical inhibition of lipid metabolism pathways

  • Technical controls:

    • Empty vector controls for overexpression

    • Non-targeting CRISPR guides

What are the best approaches for studying SPAC1A6.05c localization in S. pombe?

Understanding the subcellular localization of SPAC1A6.05c is crucial for elucidating its biological function. Multiple complementary techniques can be employed:

Fluorescent Protein Tagging:

  • C-terminal versus N-terminal tagging considerations:

    • Analyze protein domains to avoid disrupting targeting sequences

    • Test both orientations to determine optimal tag position

    • Consider using smaller tags (e.g., mNeonGreen) if standard GFP disrupts function

  • Endogenous tagging versus overexpression:

    • Endogenous tagging preserves native expression levels and regulation

    • CRISPR-Cas9 can facilitate precise integration of fluorescent tags

    • Validate functionality of tagged protein through complementation assays

  • Co-localization markers:

    • Include markers for organelles (mitochondria, endoplasmic reticulum, lipid droplets)

    • Use different fluorophores for multi-color imaging

    • Consider time-lapse imaging to track dynamic localization

Immunofluorescence:

  • Custom antibody generation:

    • Identify unique epitopes in SPAC1A6.05c

    • Validate antibody specificity using knockout controls

    • Optimize fixation and permeabilization conditions for S. pombe

  • Epitope tagging for commercial antibodies:

    • Add small epitope tags (HA, FLAG, Myc) to SPAC1A6.05c

    • Validate detection using commercial antibodies

Biochemical Fractionation:

  • Differential centrifugation:

    • Separate major cellular compartments (nucleus, mitochondria, microsomes, cytosol)

    • Track SPAC1A6.05c distribution using Western blotting

  • Density gradient separation:

    • Further resolve organelles based on density

    • Correlate SPAC1A6.05c presence with known organelle markers

  • Membrane association studies:

    • Treatment with detergents, high salt, or alkaline pH to discriminate between peripheral and integral membrane proteins

    • Determine if SPAC1A6.05c behaves as a soluble or membrane-associated protein

Data Integration:

Combine microscopy and biochemical approaches to create a comprehensive localization profile, considering that SPAC1A6.05c may have multiple localizations or shuttle between compartments depending on cellular conditions .

How can I investigate potential roles of SPAC1A6.05c in S. pombe lipid metabolism?

As a predicted triacylglycerol lipase, SPAC1A6.05c likely plays a role in lipid metabolism. A comprehensive analysis would involve:

Lipidome Analysis:

  • Lipidomics comparison between wild-type and SPAC1A6.05c mutants:

    • Use liquid chromatography-mass spectrometry (LC-MS) to analyze:

      • Triacylglycerol content and composition

      • Phospholipid profiles

      • Free fatty acid levels

      • Sterol content

    • Compare lipid profiles under different conditions (growth phases, carbon sources, stress conditions)

  • Lipid droplet analysis:

    • Nile Red or BODIPY staining for fluorescence microscopy

    • Quantitative image analysis for lipid droplet size, number, and distribution

    • Isolation of lipid droplets followed by proteomic and lipidomic analysis

Metabolic Flux Analysis:

  • Isotope labeling experiments:

    • Feed cells with ¹³C-labeled glucose or fatty acids

    • Track incorporation into lipid species over time

    • Compare flux patterns between wild-type and mutant strains

  • Respiratory measurements:

    • Oxygen consumption rates

    • Extracellular acidification rate

    • Substrate utilization patterns

Stress Response Connection:

  • Stress induction experiments:

    • Analyze SPAC1A6.05c expression and protein levels under:

      • Nutrient limitation

      • Oxidative stress

      • ER stress

      • Temperature stress

    • Determine if SPAC1A6.05c mutants show altered stress sensitivity

  • Growth phase analysis:

    • Monitor lipid metabolism changes through growth phases

    • Determine if SPAC1A6.05c is differentially regulated during stationary phase or quiescence

Pathway Interaction Studies:

  • Double mutant analysis:

    • Generate double mutants with other lipid metabolism genes

    • Analyze synthetic genetic interactions

    • Map SPAC1A6.05c within known metabolic pathways

  • Chemical-genetic interactions:

    • Test sensitivity to lipid metabolism inhibitors

    • Assess growth on different carbon sources

What approaches can be used to investigate SPAC1A6.05c protein-protein interactions?

Understanding the protein interaction network of SPAC1A6.05c can provide crucial insights into its cellular functions and regulatory mechanisms:

Affinity Purification-Mass Spectrometry (AP-MS):

  • Tandem affinity purification:

    • Tag SPAC1A6.05c with dual affinity tags (e.g., FLAG-TEV-HA)

    • Perform sequential purification to reduce background

    • Identify interacting proteins by LC-MS/MS

  • Proximity-dependent biotin labeling:

    • BioID or TurboID fusion with SPAC1A6.05c

    • In vivo biotinylation of proximal proteins

    • Streptavidin pulldown followed by MS identification

    • Map the SPAC1A6.05c proximity interactome

Yeast-Based Interaction Assays:

  • Yeast two-hybrid screening:

    • Use SPAC1A6.05c as bait against S. pombe cDNA library

    • Screen for potential interaction partners

    • Validate through coimmunoprecipitation

  • Split-ubiquitin membrane yeast two-hybrid:

    • Particularly useful if SPAC1A6.05c has membrane association

    • Detect interactions in their native cellular context

In vitro Interaction Studies:

  • Pull-down assays with recombinant proteins:

    • Express and purify SPAC1A6.05c with affinity tag

    • Incubate with cell lysates or purified candidate proteins

    • Analyze binding by SDS-PAGE and Western blotting

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI):

    • Determine binding kinetics and affinity constants

    • Characterize interaction dynamics with identified partners

Crosslinking Mass Spectrometry:

  • In vivo crosslinking:

    • Treat cells with membrane-permeable crosslinkers

    • Immunoprecipitate SPAC1A6.05c complexes

    • Identify crosslinked peptides by MS

  • XL-MS data analysis:

    • Map interaction interfaces at amino acid resolution

    • Generate structural models of complexes

Functional Validation:

  • Co-localization studies:

    • Perform dual-color imaging with identified interactors

    • Assess spatial and temporal co-localization patterns

  • Genetic interaction validation:

    • Create double mutants with genes encoding interaction partners

    • Analyze phenotypes for evidence of functional relationships

How can I interpret contradictory findings regarding SPAC1A6.05c function?

Researchers often encounter contradictory data when studying uncharacterized proteins like SPAC1A6.05c. Here's a methodological approach to resolving such contradictions:

Root Cause Analysis:

  • Experimental design differences:

    • Compare precise methodologies between contradictory studies

    • Identify variations in expression systems, tags, or assay conditions

    • Determine if differences in protein preparation affect folding or activity

  • Strain background effects:

    • Genetic differences between laboratory strains can influence phenotypes

    • Consider the potential impact of secondary mutations

    • Validate findings in multiple strain backgrounds

  • Technical variability:

    • Assess reproducibility within and between laboratories

    • Evaluate statistical analyses and sample sizes

    • Consider blinding and randomization protocols

Resolution Strategies:

  • Complementary methodologies:

    • Employ orthogonal techniques to address the same question

    • Combine in vitro biochemical assays with in vivo genetic approaches

    • Use both gain-of-function and loss-of-function studies

  • Condition-dependent functions:

    • Test function under different growth conditions

    • Consider cell cycle phases and metabolic states

    • Assess stress responses and environmental factors

  • Collaborative validation:

    • Establish collaborations with labs reporting conflicting results

    • Exchange materials, protocols, and expertise

    • Perform side-by-side experiments

Reconciliation Frameworks:

  • Multi-factorial models:

    • Develop models that incorporate seemingly contradictory data

    • Consider context-dependent functions or moonlighting activities

    • Explore regulatory mechanisms that might explain different observations

  • Unified hypothesis generation:

    • Formulate new hypotheses that account for all observations

    • Design critical experiments to test these unified hypotheses

    • Use computational approaches to integrate diverse datasets

  • Publication of contradictions:

    • Transparently report contradictory findings

    • Discuss potential explanations and limitations

    • Contribute to scientific dialogue rather than forcing consensus

What bioinformatic approaches can help predict SPAC1A6.05c interactions and metabolic pathways?

Computational methods can generate testable hypotheses about SPAC1A6.05c function and interactions:

Sequence-Based Analysis:

  • Homology detection and evolutionary analysis:

    • PSI-BLAST and HHpred for remote homolog detection

    • Multiple sequence alignment to identify conserved residues

    • Phylogenetic profiling to identify co-evolving proteins

  • Domain and motif prediction:

    • InterProScan to identify functional domains

    • ELM for linear motif detection

    • SignalP, TMHMM, and TargetP for targeting sequence prediction

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Structure-based function prediction via I-TASSER or COACH

    • Active site prediction and comparison with known lipases

Network Analysis:

  • Protein-protein interaction prediction:

    • STRING database integration

    • Interolog mapping from model organisms

    • Co-expression network analysis using PomBase expression data

  • Genetic interaction network integration:

    • Analyze genetic interaction profiles from E-MAP studies

    • Compare with interaction profiles of known lipases

    • Identify functional modules and pathway connections

Pathway Mapping:

  • Metabolic pathway analysis:

    • Map SPAC1A6.05c to KEGG lipid metabolism pathways

    • Flux balance analysis in genome-scale metabolic models

    • Predict metabolic impacts of SPAC1A6.05c perturbation

  • Multi-omics data integration:

    • Incorporate transcriptomic, proteomic, and metabolomic datasets

    • Use Bayesian networks to infer causal relationships

    • Employ machine learning for function prediction from integrated data

Case Study: Predictive Analysis of SPAC1A6.05c:

Based on the available data, computational analysis suggests:

  • SPAC1A6.05c contains a lipase domain with the canonical catalytic triad

  • Structural modeling predicts an α/β-hydrolase fold typical of lipases

  • Network analysis places it in proximity to ergosterol biosynthesis pathways

  • Genetic interaction data connects it to stress response and DNA repair

  • Subcellular localization prediction suggests potential association with lipid droplets or membranes

These computational predictions generate specific hypotheses that can be experimentally tested .

How can studies of SPAC1A6.05c inform our understanding of lipid metabolism in higher eukaryotes?

Research on SPAC1A6.05c can provide valuable insights that translate to lipid metabolism in more complex organisms:

Evolutionary Conservation Analysis:

  • Homolog identification in model organisms:

    • Map SPAC1A6.05c homologs across evolutionary space

    • Determine if functional roles are conserved in:

      • S. cerevisiae and other fungi

      • C. elegans and Drosophila

      • Vertebrate models (zebrafish, mice)

      • Human cells

  • Conservation of regulatory mechanisms:

    • Compare transcriptional and post-translational regulation

    • Identify conserved protein-protein interactions

    • Assess pathway integration across species

Translational Research Applications:

  • Disease model connections:

    • Link findings to lipid storage disorders

    • Explore connections to metabolic diseases

    • Investigate potential roles in cancer metabolism

  • Cross-species validation:

    • Test if human homologs complement S. pombe SPAC1A6.05c deletion

    • Compare biochemical properties of recombinant proteins

    • Analyze cellular phenotypes in human cell culture models

Methodological Translation:

  • Assay development:

    • Adapt successful S. pombe-based assays for higher eukaryotes

    • Develop high-throughput screening approaches

    • Create biosensors based on SPAC1A6.05c function

  • Therapeutic relevance:

    • Explore potential druggability of human homologs

    • Assess metabolic pathway targeting strategies

    • Consider lipid metabolism modulation approaches

Case Study: From Yeast to Human Systems:

S. pombe has proven to be an excellent model for translational research, particularly in cell cycle regulation and stress response. Studies of SPAC1A6.05c could follow a similar trajectory:

  • Define basic function and regulation in S. pombe

  • Identify human homologs and conserved features

  • Test functional conservation in human cells

  • Explore roles in disease contexts

  • Develop therapeutic strategies if relevant

The compact genome and genetic tractability of S. pombe make it an ideal system for discovering fundamental principles that can later be validated in more complex organisms .

What considerations should be made when comparing recombinant SPAC1A6.05c with the native protein?

Recombinant protein production is essential for biochemical and structural studies, but researchers must carefully consider potential differences from the native protein:

Expression System Considerations:

  • Post-translational modifications:

    • Prokaryotic systems (E. coli) lack eukaryotic PTMs

    • Yeast systems may have different glycosylation patterns

    • Mammalian cells provide more human-like modifications

    • Compare PTM profiles between recombinant and native protein

  • Folding environment:

    • Assess proper folding using circular dichroism

    • Compare thermal stability between recombinant and native forms

    • Consider chaperone co-expression for complex proteins

Fusion Tag Effects:

  • Functional interference:

    • Test if tags affect enzyme kinetics or substrate binding

    • Compare tagged and untagged versions where possible

    • Assess if tag removal restores native-like properties

  • Structural considerations:

    • Evaluate if tags influence oligomerization or complex formation

    • Use small tags (His) or cleavable tags for structural studies

    • Position tags to minimize interference with functional domains

Validation Strategies:

  • Activity comparison:

    • Develop assays to compare recombinant and native enzymatic parameters

    • Isolate native protein from S. pombe for side-by-side comparison

    • Assess substrate specificities and inhibitor sensitivities

  • Complementation testing:

    • Express recombinant protein in SPAC1A6.05c knockout strains

    • Determine if it rescues mutant phenotypes

    • Test different recombinant variants to map functional requirements

Analytical Approaches:

ParameterNative Protein AnalysisRecombinant Protein AnalysisValidation Method
Expression levelWestern blot, proteomicsSDS-PAGE, Western blotQuantitative comparison
LocalizationImmunofluorescence, fractionationGFP fusion, in vitro bindingCo-localization studies
Complex formationCo-IP, BN-PAGEIn vitro reconstitutionMass spectrometry
Enzymatic activityCrude extracts, partial purificationPurified protein assaysKinetic parameter comparison
RegulationIn vivo studiesIn vitro reconstitutionPhosphorylation analysis

By systematically addressing these considerations, researchers can confidently extrapolate findings from recombinant protein studies to the native cellular context .

What emerging technologies could advance our understanding of SPAC1A6.05c function?

Several cutting-edge technologies hold promise for elucidating SPAC1A6.05c's role in S. pombe biology:

Advanced Imaging Technologies:

  • Super-resolution microscopy:

    • PALM/STORM for nanoscale localization

    • SIM for improved resolution of dynamic processes

    • Track SPAC1A6.05c in relation to lipid droplets and membranes

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence localization with ultrastructural context

    • Visualize SPAC1A6.05c in relation to cellular compartments

    • Detect changes in membrane architecture in mutants

  • Live-cell metabolic imaging:

    • Fluorescent fatty acid analogs to track lipid metabolism

    • FRET-based sensors for metabolic intermediates

    • Real-time visualization of enzymatic activity

Genomic and Proteomic Advances:

  • CRISPR screens with single-cell readouts:

    • Genome-wide screens for genetic interactions

    • Single-cell transcriptomics to classify phenotypes

    • Multiplexed reporter systems for pathway activities

  • Proximity proteomics advancements:

    • TurboID or Split-TurboID for temporal control

    • Organelle-specific proximity labeling

    • Quantitative interaction dynamics

  • Proteome-wide structural studies:

    • In-cell NMR for structural dynamics

    • Hydrogen-deuterium exchange mass spectrometry

    • Crosslinking mass spectrometry for interaction interfaces

Computational and Systems Biology Approaches:

  • AI-driven protein function prediction:

    • Deep learning models integrating multiple data types

    • Improved structural predictions with AlphaFold2

    • Network-based function inference

  • Multi-scale modeling:

    • Molecular dynamics simulations of SPAC1A6.05c

    • Cell-scale metabolic models incorporating lipid dynamics

    • Population-level phenotypic modeling

  • Synthetic biology applications:

    • Designer lipid metabolism pathways

    • Biosensors based on SPAC1A6.05c activity

    • Minimal cell systems for pathway reconstitution

Translational Approaches:

  • Single-molecule enzymology:

    • Observe individual catalytic events

    • Characterize conformational dynamics

    • Detect heterogeneity in enzyme populations

  • Organoid and cell-type specific studies:

    • Transfer findings to more complex cellular contexts

    • Study tissue-specific functions of homologs

    • Explore metabolic compartmentalization

By integrating these emerging technologies, researchers can develop a comprehensive understanding of SPAC1A6.05c function in lipid metabolism and potentially discover unexpected roles in cellular processes .

How might comparative proteomics inform SPAC1A6.05c functional characterization?

Comparative proteomics offers powerful approaches to elucidate SPAC1A6.05c function through systematic analysis of protein expression, modification, and interaction changes:

Quantitative Proteomics Strategies:

  • Differential expression analysis:

    • Compare wild-type vs. SPAC1A6.05c deletion/overexpression strains

    • Use iTRAQ or TMT labeling for multiplexed quantification

    • Apply label-free approaches for broader coverage

    • Identify pathways affected by SPAC1A6.05c perturbation

  • Post-translational modification profiling:

    • Phosphoproteomics to detect signaling changes

    • Glycoproteomics for secretory pathway effects

    • Lipidomics to characterize changes in lipid profiles

    • Connect modifications to functional changes

  • Protein-protein interaction networks:

    • Affinity purification-mass spectrometry under various conditions

    • Compare interactome across growth phases and stress conditions

    • Identify condition-specific interaction partners

Experimental Design for Maximum Insight:

  • Temporal dynamics analysis:

    • Time-course experiments after genetic perturbation

    • Capture immediate vs. adaptive responses

    • Track protein expression changes during cell cycle progression

  • Subcellular proteomics:

    • Organelle isolation followed by proteomics

    • Track redistribution of proteins between compartments

    • Characterize composition of lipid droplets and membranes

  • Environment-specific responses:

    • Compare proteome changes under different carbon sources

    • Analyze stress response mechanisms

    • Identify condition-specific functions

Data Integration Framework:

Comparative proteomics generates massive datasets that require sophisticated integration:

  • Multi-omics integration:

    • Combine proteomics with transcriptomics and metabolomics

    • Correlate protein changes with metabolite profiles

    • Identify regulatory networks through integrated analysis

  • Pathway enrichment and network analysis:

    • Map changed proteins to known pathways

    • Identify enriched biological processes

    • Construct protein-protein interaction networks

  • Evolutionary conservation mapping:

    • Compare proteome responses across species

    • Identify conserved and divergent functional modules

    • Map human ortholog functions based on yeast findings

Case Study: Proteome Analysis in S. pombe:

Previous proteome analyses in S. pombe have successfully revealed:

  • Changes in protein levels across numerous biological pathways

  • Targets for genetic engineering to improve protein secretion

  • Connections between amino acid biosynthesis and membrane fluidity

  • Novel roles for previously uncharacterized proteins

Similar approaches could position SPAC1A6.05c within specific metabolic or signaling networks and identify unexpected functional connections .

By applying comprehensive proteomics approaches, researchers can develop testable hypotheses about SPAC1A6.05c function that integrate molecular mechanisms with cellular physiology and systems-level understanding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.