Recombinant Schizosaccharomyces pombe Uncharacterized protein C23A1.02c (SPAC23A1.02c)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Schizosaccharomyces pombe Uncharacterized protein C23A1.02c (SPAC23A1.02c) is a protein derived from the fission yeast Schizosaccharomyces pombe . The protein is also referred to as Uncharacterized protein C23A1.02c . Due to its "uncharacterized" status, its precise function remains largely unknown .

Basic Information

  • Source Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)

  • Protein Type: Recombinant protein

  • UniProt ID: O42841

  • Amino Acid Sequence Length: 430 residues

Amino Acid Sequence

The amino acid sequence for SPAC23A1.02c is :
MFARHPNLLWLNKQLSILHYLCLVFLAVYYAYPLLFGIMPRKLQLEDENSFVIMGVADPQIEGNHKIEANGFFKGTLDLWGNDLFLRHLVHMNQFWGQPDAMILLGDLVSFQHLDNEEFNKRAKRLKKITGAKNFWQVGNSSLPARTFENGNIPVWTIAGNHDIGYGCESSDAQISKWEQAMGPVNWVSHFNVSKFPVRVIGINSLSLDDVQFYDANPSDIINSKSFSSLGILALSKEARDAWQFLFDIALEPSIPTILFTHVPLYKPANVCVDEPRIVRQLDFRVKSQNHLSYNTTMKIFELIPSIKLVLSGHDHMGCDYEHPNGAIEHTLPSAMGYFGGNIGFVKLIATNDVLTESSKNTPSVVTFLIQKLIGQRWKKASLKQSKFSSDIYATYTLSHGGPSYIWWALHISVCVLTILRLLVISLQHI

Gene Information

  • Gene Names: SPAC23A1.02c

  • ORF Names: SPAC23A1.02c

Expression

The protein is expressed in the region spanning the entire sequence, from amino acid 1 to 430 .

Potential Functions and Role in Cellular Processes

While SPAC23A1.02c is currently classified as an uncharacterized protein, studies on Schizosaccharomyces pombe provide some context for its potential functions:

  • S. pombe as a Model Organism: S. pombe is used in studies of eukaryotic cell cycle regulation, stress responses, and DNA repair mechanisms .

  • Involvement in Protein Complexes: Some S. pombe proteins are components of high-molecular-weight complexes involved in DNA repair .

  • Regulation of Actin Assembly: Proteins in S. pombe can regulate actin assembly during endocytosis .

Because SPAC23A1.02c is uncharacterized, assigning specific functions based on current data is difficult. Further experimental studies would be needed to elucidate its precise role.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
SPAC23A1.02c; Uncharacterized protein C23A1.02c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-430
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC23A1.02c
Target Protein Sequence
MFARHPNLLWLNKQLSILHYLCLVFLAVYYAYPLLFGIMPRKLQLEDENSFVIMGVADPQ IEGNHKIEANGFFKGTLDLWGNDLFLRHLVHMNQFWGQPDAMILLGDLVSFQHLDNEEFN KRAKRLKKITGAKNFWQVGNSSLPARTFENGNIPVWTIAGNHDIGYGCESSDAQISKWEQ AMGPVNWVSHFNVSKFPVRVIGINSLSLDDVQFYDANPSDIINSKSFSSLGILALSKEAR DAWQFLFDIALEPSIPTILFTHVPLYKPANVCVDEPRIVRQLDFRVKSQNHLSYNTTMKI FELIPSIKLVLSGHDHMGCDYEHPNGAIEHTLPSAMGYFGGNIGFVKLIATNDVLTESSK NTPSVVTFLIQKLIGQRWKKASLKQSKFSSDIYATYTLSHGGPSYIWWALHISVCVLTIL RLLVISLQHI
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems have been validated for producing recombinant SPAC23A1.02c?

Several expression systems have been successfully employed for SPAC23A1.02c production:

Expression SystemValidatedTagsPurityNotes
E. coliYesHis>90%Most commonly used system
YeastAvailableVariousVariableAlternative for eukaryotic modifications
Insect cellAvailableVariousVariableComplex glycosylation possible
MammalianAvailableVariousVariableHighest complexity modifications

For E. coli expression, optimal conditions include:

  • Expression in BL21(DE3) or similar strains

  • N-terminal His-tag for purification

  • IPTG induction at lower temperatures (16-25°C) to improve solubility

  • Cell lysis in Tris/PBS-based buffer systems

For experiments requiring authentic post-translational modifications, expression in S. pombe itself may be preferable using established transformation protocols with lithium acetate/DMSO methods .

What are the optimal storage and handling conditions for recombinant SPAC23A1.02c?

Purified SPAC23A1.02c requires careful handling to maintain stability and activity:

  • Long-term storage:

    • Store at -20°C/-80°C

    • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Add 50% glycerol as cryoprotectant

    • Aliquot to avoid freeze-thaw cycles

  • Reconstitution protocol:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Mix gently until completely dissolved

  • Working conditions:

    • Working aliquots stable at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

    • Test buffer optimization if activity issues arise

How can transcriptomic approaches be applied to understand SPAC23A1.02c?

Transcriptomic analysis can reveal expression patterns and potential functions:

  • RNA isolation protocol:

    • Use TRIzol™ Reagent for initial homogenization

    • Add chloroform and separate aqueous layer containing RNA

    • Precipitate RNA using isopropanol

    • Prepare cDNA libraries for sequencing

  • Experimental designs:

    • Compare wild-type vs. SPAC23A1.02c deletion/overexpression strains

    • Analyze expression across cell cycle using synchronized cultures

    • Test expression under various stress conditions

    • Integrate with datasets of known cell cycle-regulated genes (747 genes have been identified in S. pombe)

  • Data analysis approaches:

    • Identify co-regulated genes for pathway inference

    • Search for enriched promoter motifs (MCB, PCB, SFF motifs are important in S. pombe)

    • Compare expression patterns with orthologs in other species

What assays can determine if SPAC23A1.02c participates in meiotic recombination?

S. pombe is an excellent model for studying meiotic recombination. To assess SPAC23A1.02c involvement:

  • Intragenic recombination (gene conversion):

    • Use established genetic assays with appropriate alleles

    • Measure frequency in wild-type vs. mutant backgrounds

    • Analyze patterns of conversion events

  • Intergenic recombination (crossing-over):

    • Employ genetic markers on either side of recombination sites

    • Quantify crossover frequencies in the presence/absence of SPAC23A1.02c

    • Map distributions of recombination events

  • Spore viability assessment:

    • Perform tetrad analysis of sporulated cells

    • Compare viability patterns between wild-type and mutant strains

    • Analyze segregation patterns for evidence of meiotic defects

  • Recombination at repetitive elements:

    • Apply specialized assays for non-tandem repeats

    • Analyze deletion, inversion, or duplication events

    • Compare frequency in presence/absence of SPAC23A1.02c

How does SPAC23A1.02c expression change during the cell cycle or under stress conditions?

Understanding expression dynamics provides functional insights:

  • Cell cycle regulation:

    • Determine if SPAC23A1.02c belongs to the 747 genes with cell cycle-regulated expression in S. pombe

    • Identify potential regulatory motifs in the promoter region (MCB, PCB, SFF)

    • Analyze synchronous cultures using elutriation or block-and-release methods

    • Compare expression patterns across cell cycle phases:

Cell Cycle PhaseKey Regulatory MotifsNumber of Regulated Genes
G1/SMCB (bound by DSC/MBF complexes)~ 40 characterized genes
M/G1PCB/SFF (bound by PBF factors)Multiple clusters identified
G2VariousSeveral genes (cdc25, rum1, wis3)
  • Stress response patterns:

    • Examine if SPAC23A1.02c is regulated by Atf1/Pcr1 transcription factors

    • Test expression under oxidative stress, heat shock, nutrient limitation

    • Consider how cell cycle and stress response programs integrate

What is known about the potential chromosomal context and chromatin environment of SPAC23A1.02c?

Chromatin context can provide functional insights:

  • Chromosomal position analysis:

    • Map the exact position in the S. pombe genome

    • Determine if located in specialized chromatin regions

    • Analyze nearby genes for functional relationships

  • Chromatin immunoprecipitation approaches:

    • Perform ChIP experiments to identify associated factors

    • Analyze histone modifications at the SPAC23A1.02c locus

    • Consider potential regulation by Swi6 (HP1 homolog in S. pombe)

How might SPAC23A1.02c function relate to chromosome stability or genomic integrity?

Given S. pombe's importance as a model for genome stability:

  • Sensitivity assays:

    • Test SPAC23A1.02c deletion/overexpression strains for sensitivity to:

      • DNA damaging agents (MMS, UV, hydroxyurea)

      • Replication stress inducers

      • Spindle poisons

    • Quantify chromosome loss rates

  • Recombination assays:

    • Implement established mitotic recombination assays

    • Look for changes in homologous recombination efficiency

    • Assess non-homologous end joining capability

    • Monitor effects on repeat stability

  • Genetic interaction studies:

    • Test interactions with known genome stability factors

    • Look for synthetic lethality/sickness with DNA repair pathway components

    • Analyze double mutants with cell cycle checkpoint proteins

How can ortholog analysis between S. pombe and S. cerevisiae inform SPAC23A1.02c research?

Comparative analysis between different yeast species provides valuable functional insights:

  • Expression pattern comparisons:

    • Determine if SPAC23A1.02c has orthologs in S. cerevisiae

    • Compare expression timing during cell cycle (concordant vs. discordant patterns)

    • Note that DNA replication/chromosome structure genes typically show concordant patterns between species, while metabolism/cell wall genes often show discordant patterns

  • Functional complementation:

    • Test if SPAC23A1.02c can complement deletion of its ortholog in other species

    • Conversely, test if orthologs can complement SPAC23A1.02c deletion in S. pombe

    • Identify conserved vs. species-specific functions

  • Promoter architecture analysis:

    • Compare regulatory motifs between orthologs

    • Test conservation of transcription factor binding sites

    • Analyze evolutionary conservation of expression patterns

What techniques can determine if SPAC23A1.02c is involved in chromosome dynamics during aneuploidy?

S. pombe studies on aneuploidy can inform SPAC23A1.02c research:

  • Expression analysis in aneuploid strains:

    • Measure SPAC23A1.02c expression in partial aneuploid strains

    • Compare to genome-wide expression patterns in aneuploids

    • Note that expression typically increases proportionally with gene copy number (disomic: ~1.917×, trisomic: ~2.813×)

  • Minichromosome stability assays:

    • Analyze stability of minichromosomes (Ch16, S28, Ch10) in SPAC23A1.02c mutants

    • Monitor loss rates through colony sectoring assays

    • Compare to known chromosomal stability mutants

  • Chromosome structure analysis:

    • Use pulsed-field gel electrophoresis to monitor chromosome integrity

    • Employ array-based comparative genomic hybridization (CGH)

    • Visualize chromosome dynamics during mitosis and meiosis

What approaches can identify interaction partners of SPAC23A1.02c?

Understanding protein interactions is crucial for functional characterization:

  • Affinity purification-mass spectrometry:

    • Express tagged SPAC23A1.02c in S. pombe

    • Purify under various conditions (stringent vs. mild)

    • Identify co-purifying proteins by mass spectrometry

    • Validate top candidates through reverse purifications

  • Yeast two-hybrid screening:

    • Screen against S. pombe genomic or cDNA libraries

    • Test directed interactions with predicted partners

    • Consider limitations for membrane proteins

  • Co-immunoprecipitation validation:

    • Perform reciprocal co-IPs with candidate interactors

    • Test interactions under different cellular conditions

    • Analyze domain requirements for interactions

  • Proximity labeling approaches:

    • Consider BioID or APEX2 fusions for in vivo proximity labeling

    • Identify neighboring proteins in native cellular context

    • Particularly valuable for membrane-associated proteins

How can enzymatic activity of SPAC23A1.02c be assessed?

For uncharacterized proteins, systematic activity testing is essential:

  • Predictive approaches:

    • Use sequence motifs to predict potential enzymatic activities

    • Compare to characterized enzyme families

    • Design targeted activity assays based on predictions

  • In vitro activity screening:

    • Test purified recombinant protein with diverse substrates

    • Monitor various potential activities:

      • Hydrolase/deubiquitylase activity (like USP22)

      • Transferase activity

      • Binding to specific cellular components

  • Control experiments:

    • Include enzymatically inactive mutants (catalytic residue mutations)

    • Use related enzymes as positive controls

    • Test activity under various buffer conditions

How does post-translational modification affect SPAC23A1.02c function?

Post-translational modifications often regulate protein function:

  • Modification site mapping:

    • Perform mass spectrometry analysis of purified protein

    • Identify phosphorylation, ubiquitination, methylation sites

    • Compare modifications across different cellular conditions

  • Functional impact testing:

    • Generate non-modifiable mutants (e.g., S→A for phosphosites)

    • Create phosphomimetic mutants (e.g., S→E)

    • Test functional consequences in vivo

  • Cell cycle-dependent modifications:

    • Analyze modifications throughout cell cycle

    • Identify regulatory enzymes (kinases, phosphatases)

    • Connect modifications to functional changes

What strategies help overcome challenges in SPAC23A1.02c expression and purification?

Common challenges and solutions include:

  • Protein solubility issues:

    • Test multiple expression temperatures (16°C, 25°C, 30°C)

    • Try different solubilizing additives (detergents, high salt)

    • Consider fusion tags that enhance solubility (MBP, SUMO, GST)

    • Express protein domains separately if full-length proves difficult

  • Purification optimization:

    • Test multiple buffer conditions (pH 6.0-8.5)

    • Optimize salt concentration (50-500 mM)

    • Add stabilizing agents (glycerol, trehalose)

    • Consider on-column refolding for inclusion bodies

  • Expression level enhancement:

    • Optimize codon usage for expression system

    • Test multiple promoter strengths

    • Consider co-expression with chaperones

    • Try autoinduction media for E. coli expression

How can researchers address inconsistent results in SPAC23A1.02c phenotypic studies?

Phenotypic analysis requires careful experimental design:

  • Genetic background consistency:

    • Ensure strains share identical genetic backgrounds except for target gene

    • Use multiple independently derived mutants

    • Complement mutants to confirm phenotype specificity

  • Condition standardization:

    • Strictly control temperature, media composition, cell density

    • Document exact growth conditions and synchronization methods

    • Use internal controls to normalize between experiments

  • Statistical robustness:

    • Perform sufficient biological and technical replicates

    • Apply appropriate statistical tests

    • Report variability transparently

    • Consider blinded analysis for subjective phenotypes

What controls are essential when conducting gene expression studies involving SPAC23A1.02c?

Proper controls ensure reliable gene expression data:

  • RNA quality controls:

    • Verify RNA integrity using bioanalyzer or gel electrophoresis

    • Check for genomic DNA contamination

    • Include no-RT controls in qPCR experiments

  • Reference gene selection:

    • Validate stability of reference genes under experimental conditions

    • Use multiple reference genes for normalization

    • Consider spike-in controls for absolute quantification

  • Validation approaches:

    • Confirm microarray results with qRT-PCR

    • Verify protein-level changes when possible

    • Include biological replicates to assess variability

    • Test both overexpression and deletion phenotypes

How might SPAC23A1.02c research contribute to understanding conserved eukaryotic cellular processes?

Research on uncharacterized S. pombe proteins can have broad implications:

  • Model organism advantages:

    • S. pombe provides insights into conserved eukaryotic processes

    • Findings can translate to higher eukaryotes including humans

    • Less genetic redundancy simplifies functional analysis

  • Cell cycle regulation insights:

    • S. pombe has contributed fundamental discoveries in cell cycle control

    • SPAC23A1.02c may connect to established regulatory networks

    • Compare findings with other model systems (S. cerevisiae, human cells)

  • Evolutionary conservation assessment:

    • Determine if SPAC23A1.02c belongs to an ancient, conserved protein family

    • Identify functional domains maintained across species

    • Use conservation patterns to predict critical functional regions

What gene expression signatures might be affected by SPAC23A1.02c manipulation?

Gene expression analysis provides functional context:

  • Transcriptome profiling approaches:

    • Compare wild-type vs. SPAC23A1.02c deletion or overexpression

    • Analyze under various conditions (normal growth, stress, cell cycle stages)

    • Look for gene ontology enrichment in affected genes

  • Comparison with known signatures:

    • Determine if SPAC23A1.02c affects established transcriptional programs

    • Compare to signatures from known transcription factor mutations

    • Search for overlap with stress response or cell cycle signatures

  • Pathway integration:

    • Search result indicates SPAC23A1.02c may be involved in specific pathways:

      • RNA catalytic activity pathways (p-value: 3.78e-05)

      • tRNA metabolic processes (p-value: 0.002)

      • DNA recombination (p-value: 0.133)

How can multi-omics approaches be integrated to comprehensively characterize SPAC23A1.02c function?

Modern functional genomics requires integrated approaches:

  • Multi-omics integration strategies:

    • Combine transcriptomics, proteomics, metabolomics data

    • Correlate changes across different data types

    • Use network analysis to identify functional modules

  • Implementation approaches:

    • Profile SPAC23A1.02c deletion/overexpression across multiple omics layers

    • Compare responses to perturbations across different conditions

    • Apply computational integration tools to identify patterns

  • Validation experiments:

    • Test specific hypotheses generated from integrated analysis

    • Focus on nodes with strongest multi-omics evidence

    • Validate with targeted biochemical or genetic experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.