Recombinant Schizosaccharomyces pombe Uncharacterized protein C23C11.17 (SPAC23C11.17)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe Uncharacterized protein C23C11.17 (SPAC23C11.17) is a protein derived from the fission yeast Schizosaccharomyces pombe . The S. pombe genome encodes this protein, which is also known as mdm28 and LETM1 domain-containing protein mdm28, mitochondrial .

Basic Characteristics

CharacteristicDescription
SpeciesSchizosaccharomyces pombe
Synonymsmdm28; SPAC23C11.17; LETM1 domain-containing protein mdm28, mitochondrial
Gene Namemdm28
Protein LengthFull Length is 485 amino acids
Molecular WeightPredicted to be approximately 53.9 kDa [no citation found]
Purity≥ 85% as determined by SDS-PAGE or Greater than 90% as determined by SDS-PAGE
TagHis-Tagged

Production and Sourcing

Recombinant SPAC23C11.17 is typically produced in E. coli . Expression systems utilizing Schizosaccharomyces pombe itself are also established for eukaryotic protein production, offering advantages such as post-translational modifications that are critical for the structure and function of eukaryotic proteins . The protein can also be expressed in Cell Free Expression, Yeast, Baculovirus or Mammalian Cell .

Research Applications

Recombinant SPAC23C11.17 is used in various biochemical and biophysical studies. It is available for in vitro research purposes and is not intended for human consumption .

Related Proteins in Schizosaccharomyces pombe

Schizosaccharomyces pombe possesses several proteins involved in DNA repair and maintenance, reflecting the importance of these processes in cellular function . Examples include:

  1. Mag1 and Mag2: Two paralogs of alkA, involved in removing alkylation products from DNA .

  2. Nth1p: A protein with broad substrate specificity, excising various pyrimidine-derived lesions from oxidized DNA .

  3. Myh1: A MutY homolog that recognizes A:G and A:8-oxoG mispairs, preventing C:G to G:C transversion mutations .

  4. Rad18: An essential gene involved in the repair of DNA damage produced by ionizing radiation and in tolerance of UV-induced DNA damage .

  5. Cka1 (SPAC23C11.11): A serine/threonine protein kinase involved in various cellular processes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdm28; SPAC23C11.17; LETM1 domain-containing protein mdm28, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-485
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
mdm28
Target Protein Sequence
MKYPRTHIQFPSMLRNRLFKTPHQTGFQWRLGAPATGITIRNQPIRSYSGLRGNFLIDKR LSPVKFNKYSPSDIVFYNIGSSRLYSTETPTPSKVKEAPKQVAAEETKPTTVVKKPSIWQ RVKGGVLHFWDGTKLLGVEIKISSKLVYKMAVGYELTRRESRQLTRTLKDIGRLVPFSVF VVVPFAELLLPIAVKLFPNLLPSTFEDAKDKEAKKAQLRKTRNEVSNMLRSTLKSGKFTF SNETRESKEFRDFFQKVRTSGQSPSREELIEVCKYFKDDITLDNLSRAQLVAMCRYMNLN AFGTDPLLRYNIRHRMRQIRRDDRAIYIEGINSLSIPELFNACNSRGIRTQGLSPAKLKE ELSVWLDMRIKHGIPSVILMLSNAFSYGYNEGTYDSRWDALQDTLASIPDELYHETVVDM PTKQVSNKERLEILREQEELIEEEAEHVAEHPDLAKKQTEENKATSKPAVSAKSPESNIP KNERK
Uniprot No.

Target Background

Function
This protein is involved in regulating mitochondrial potassium homeostasis via mitochondrial K+/H+ exchange.
Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What are the optimal protocols for handling recombinant SPAC23C11.17?

Reconstitution and Storage Protocol:

  • Centrifuge vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store stock at -20°C or -80°C for extended storage

Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. Working aliquots should be maintained at 4°C and used within one week .

What vector systems are most appropriate for stable integration and expression of SPAC23C11.17 in S. pombe?

When designing experiments to study SPAC23C11.17 function through genetic manipulation, researchers should consider the stability of integration vectors. Recent research has shown that commonly used fission yeast vectors can produce unstable genomic loci due to repetitive regions .

Recommended Vector Systems:

  • Stable Integration Vectors (SIVs) targeting prototrophy genes create non-repetitive, stable genomic loci and predominantly integrate as single copy

  • Complementary auxotrophic alleles can preclude false-positive integration events

  • Modular vector systems that include antibiotic resistance markers, promoters, fluorescent tags, and terminators provide flexibility

Stability Assessment Data:

Vector Type5-FOA Resistant ColoniesAntibiotic Resistant (%)
Standard VectorsHigh proportionVariable
SIVsSignificantly lower>95%

Experimental data shows that SIVs produce more stable integrations with reduced frequency of false-positive colonies lacking the fluorescent marker (typically <5% compared to >25% with conventional vectors) .

How can I optimize transformation efficiency when introducing SPAC23C11.17 constructs into S. pombe?

Efficient transformation is critical for genetic manipulation studies. For S. pombe, homology-targeted repair can be exploited to precisely edit the genome . The following protocol optimizes transformation efficiency:

  • Use exponentially growing cells (OD600 0.4-0.8)

  • Harvest cells by centrifugation and wash in ice-cold 1M sorbitol

  • Resuspend in lithium acetate/TE buffer

  • Add transformation DNA with carrier DNA

  • Heat shock at 42°C for 15 minutes

  • Plate on selective media

  • Incubate at 30°C for 3-5 days

For SPAC23C11.17 constructs, ensure 40-60bp homology arms flanking the integration site to enhance homologous recombination efficiency .

What approaches can effectively determine the function of this uncharacterized protein?

Given the uncharacterized nature of SPAC23C11.17, a multi-faceted approach is recommended:

Comparative Genomics Approach:

  • Sequence homology analysis with related fungi and other eukaryotes

  • Structural prediction based on conserved domains

  • Phylogenetic analysis to identify evolutionary relationships

Experimental Functional Analysis:

  • Gene deletion/disruption studies to observe phenotypic effects

  • Localization studies using GFP or other fluorescent tags

  • Protein-protein interaction studies via yeast two-hybrid or co-immunoprecipitation

  • Transcriptional profiling under various conditions to identify regulatory relationships

Systems Biology Integration:

  • Network analysis to place SPAC23C11.17 in cellular pathways

  • Metabolomic analysis to identify biochemical changes upon protein disruption or overexpression

  • Integrative analysis combining multiple data types for functional prediction

How can mitotic recombination assays be utilized to study potential roles of SPAC23C11.17?

S. pombe provides powerful in vivo genetic assays for studying DNA damage repair and mitotic recombination. If SPAC23C11.17 is suspected to play a role in these processes, the following assays can be implemented:

Chromosome Loss Assay:

  • Utilize truncated chromosome III (Ch16) marked with appropriate selectable markers

  • Monitor loss rates in wild-type versus SPAC23C11.17 mutant backgrounds

  • Quantify through colony color assays and confirm by pulse field gel electrophoresis

Recombination at Repetitive Elements:

  • Implement non-tandem repeat assays with overlapping markers

  • Measure crossover frequency at specific loci

  • Compare rates between wild-type and mutant strains

These assays can detect subtle phenotypes related to genome stability functions that might not be obvious in standard growth assays.

How can transcriptomic analyses inform our understanding of SPAC23C11.17 function?

Transcriptomic analyses provide valuable insights into gene function through patterns of co-expression and differential regulation. For SPAC23C11.17, consider:

RNA-Seq Experimental Design:

  • Compare wild-type and SPAC23C11.17 deletion/mutant strains

  • Analyze under various stress conditions (oxidative, temperature, nutritional)

  • Examine during different cell cycle stages and developmental transitions

  • Integrate with ChIP-seq data if transcription factor activity is suspected

Data Analysis Framework:

  • Differential expression analysis to identify affected genes

  • Gene Ontology enrichment to determine biological processes impacted

  • Co-expression network analysis to identify functional associations

  • Pathway analysis to place findings in biological context

For RNA-Seq data analysis, implement both descriptive analysis (understanding data characteristics) and diagnostic analysis (investigating relationships between variables) before moving to predictive and prescriptive analyses .

What bioinformatic approaches can predict potential functions of SPAC23C11.17 based on structural features?

Predictive bioinformatics can provide valuable insights when experimental data is limited:

Structural Prediction Pipeline:

  • Primary sequence analysis for conserved motifs and domains

  • Secondary structure prediction using algorithms like PSIPRED

  • Tertiary structure modeling using homology modeling or ab initio prediction

  • Functional site prediction for enzymatic activity, binding sites, or post-translational modifications

Comparative Genomics Strategy:

  • Identify orthologs across species using reciprocal BLAST

  • Perform multiple sequence alignment to identify conserved regions

  • Analyze synteny to determine genomic context conservation

  • Examine patterns of selection pressure using dN/dS ratios

Based on current sequence analysis, SPAC23C11.17 contains a LETM1 domain, suggesting potential mitochondrial localization and involvement in ion transport or homeostasis .

How should I design experiments to disambiguate SPAC23C11.17 function from other cellular processes?

When investigating uncharacterized proteins, clearly distinguishing their specific functions requires carefully controlled experiments:

Conditional Expression Systems:

  • Utilize the nmt1 promoter system (repressed by thiamine) for controlled expression

  • Consider the faster urg1 promoter system (induction within 30 minutes) for time-sensitive experiments

Genetic Background Controls:

  • Always include isogenic wild-type controls

  • Consider complementation tests with the wild-type gene to confirm phenotype specificity

  • Use multiple independently generated mutant strains to confirm reproducibility

  • Create double mutants with known pathway components to test for genetic interactions

Temporal Resolution Approaches:

  • For cell cycle studies, synchronize cultures using cdc25 temperature-sensitive mutants

  • For meiotic studies, use pat1 temperature-sensitive mutants or nitrogen starvation protocols

  • Monitor phenotypes at multiple timepoints to capture dynamic effects

What controls and validation steps are essential when studying protein-protein interactions involving SPAC23C11.17?

Protein interaction studies require rigorous controls and validation:

Experimental Controls for Co-Immunoprecipitation:

  • Input samples to confirm protein expression

  • Negative controls using unrelated antibodies or non-expressing strains

  • Reciprocal IP using antibodies against each potential interacting partner

  • DNase/RNase treatment to rule out nucleic acid-mediated interactions

Validation Strategy:

  • Confirm interactions by multiple independent methods (Y2H, BiFC, FRET)

  • Test interaction with truncated versions of the protein to map interaction domains

  • Verify biological relevance through functional assays

  • Create point mutations in predicted interaction sites to confirm specificity

Document interaction data systematically with detailed experimental conditions to ensure reproducibility across research groups.

What statistical approaches are most appropriate for analyzing SPAC23C11.17 experimental data?

Statistical analysis of data involving SPAC23C11.17 should follow these principles:

Quantitative Analysis Framework:

  • Determine appropriate sample sizes through power analysis before experiments

  • Apply normality tests to determine distribution of your data

  • Use parametric tests (t-tests, ANOVA) for normally distributed data

  • Apply non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) when normality assumptions are violated

  • Implement multiple testing correction for genome-wide studies

Visual Representation Guidelines:

How can I integrate multiple data types to build a comprehensive model of SPAC23C11.17 function?

Integration of diverse data types provides a more complete understanding:

Data Integration Strategy:

  • Standardize data formats across experimental platforms

  • Apply dimension reduction techniques (PCA, t-SNE) to identify patterns

  • Implement weighted integration methods that account for varying reliability

  • Use Bayesian approaches to update functional predictions as new data becomes available

Systems Biology Modeling:

  • Start with correlation networks to identify associations

  • Progress to directional networks using time-series data

  • Develop mathematical models of relevant pathways

  • Validate model predictions with targeted experiments

Data integration should follow a systematic progression from descriptive to diagnostic, then predictive and finally prescriptive analysis as understanding increases .

What strategies can address protein stability issues with recombinant SPAC23C11.17?

Protein stability challenges are common with recombinant proteins:

Optimization Approaches:

  • Test multiple expression conditions (temperature, induction time, media composition)

  • Screen various fusion tags (His, GST, MBP) for improved solubility

  • Optimize buffer conditions (pH, salt concentration, reducing agents)

  • Consider co-expression with chaperones

  • Test different E. coli strains optimized for protein expression

Stability Evaluation Matrix:

ParameterVariables to TestAssessment Method
Temperature16°C, 25°C, 30°C, 37°CSDS-PAGE/Western
Induction Period2h, 4h, 8h, overnightActivity assay
IPTG Concentration0.1mM, 0.5mM, 1.0mMYield quantification
Buffer pH6.5, 7.0, 7.5, 8.0Stability monitoring

For long-term storage, the addition of glycerol (50% final concentration) significantly improves stability .

How can I verify the authenticity and integrity of SPAC23C11.17 after purification?

Quality control is essential for ensuring experimental reproducibility:

Verification Protocol:

  • SDS-PAGE to confirm molecular weight (expected ~54 kDa for the full-length protein plus tag)

  • Western blot with anti-His antibody to confirm tag presence

  • Mass spectrometry for definitive identification

  • Circular dichroism to assess secondary structure integrity

  • Dynamic light scattering to evaluate homogeneity and aggregation state

Integrity Assessment Methods:

  • Limited proteolysis to probe folding state

  • Thermal shift assays to determine stability

  • Activity assays if functional predictions exist

  • N-terminal sequencing to confirm proper translation initiation

Document all quality control data meticulously to ensure comparability across experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.